| General Information |
| MoonProt ID | 9 |
| First appeared in release | 1.0 |
| Name(s) | 6-phosphofructokinase
Short name=Phosphofructokinase
Alternative name(s):
Phosphohexokinase
Gene Name:pfkA
|
| UniProt ID | P0DOB5 |
| GO terms | GO:0006002 fructose 6-phosphate metabolic process
GO:0006096 glycolysis
GO:0016310 phosphorylation
GO:0008152 metabolic process
GO:0046835 carbohydrate phosphorylation
GO:0000166 nucleotide binding
GO:0003824 catalytic activity
GO:0003872 6-phosphofructokinase activity
GO:0005524 ATP binding
GO:0008443 phosphofructokinase activity
GO:0016301 kinase activity
GO:0016740 transferase activity
GO:0046872 metal ion binding
GO:0005737 cytoplasm
GO:0005945 6-phosphofructokinase complex
|
| Organisms for which functions have been demonstrated | Lactococcus lactis IL1403 (Gram positive bacterium) |
| Sequence length | 340 |
| FASTA sequence | >sp|P0DOB5|PFKA_LACLA ATP-dependent 6-phosphofructokinase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pfkA PE=3 SV=1
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGIEVYGINHGYAGMVAGDIFPLTSASVGDKIGRGGTFLYSARYPEFAQVEGQLAGIEQLKKFGIEGVVVIGGDGSYHGAMRLTEHGFPAVGLPGTIDNDIVGTDFTIGFDTAVSTVVDALDKIRDTSSSHNRTFVVEVMGRNAGDIALNAGIAAGADDICIPEKEFKFENVVNNINKGYEKGKNHHIIVLAEGVMTGEEFATKLKEAGYKGDLRVSVLGHIQRGGSPTARDRVLASRMGARAVELLRDGIGGVAVGIRNEELVESPILGTAEEGALFSLTTEGGIKVNNPHKAGLELYRLNSALNNLNLN
|
| Structure Information |
| PDB ID | closest homolog with structure in PDB is Bacillus sterothermophilus at 66% amino acid sequence identity |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 336-340 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | 6-phosphofructokinase, enzyme
ATP + D-fructose 6-phosphate => ADP + D-fructose 1,6-bisphosphate
Carbohydrate degradation, glycolysis
|
| References for function | |
| E.C. number | 2.7.1.11 |
| Location of functional site(s) | |
| Cellular location of function | Cytoplasm |
| Comments | |
| Function 2 |
| Function description | binding to invertase, a hyperglycosylated
mannoprotein from Saccharomyces cerevisiae |
| References for function | Katakura Y, Sano R, Hashimoto T, Ninomiya K, Shioya S. 2010. Lactic
acid bacteria display on the cell surface cytosolic proteins that recognize yeast mannan. Appl. Microbiol. Biotechnol. 86:319 326. PMID: 19898842 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | Cell surface |
| Comments | Involved in symbiotic relationship between lactic acid bacteria (LAB) and yeast. LAB break down starch and other carbohydrates and provide lactic acid to yeast while receiving some nutrients from the yeast. This bacteria and yeast symbiosis is found in some fermented foods like kefir, a type of fermented milk. |