Protein Information

General Information
MoonProt ID91
First appeared in release1.0
Name(s)Phosphoglyceromutase GPM1 Phosphoglycerate mutase PGAM BPG-dependent PGAM MPGM Gene Name: GPM1
UniProt IDP82612 (PMGY_CANAL), Reviewed
GO termsGO:0006096 glycolysis GO:0008150 biological_process GO:0008152 metabolic process GO:0051701 interaction with host GO:0003674 molecular_function GO:0003824 catalytic activity GO:0004619 phosphoglycerate mutase activity GO:0005515 protein binding GO:0016853 isomerase activity GO:0016868 intramolecular transferase activity, phosphotransferases GO:0005575 cellular_component GO:0005737 cytoplasm GO:0009277 fungal-type cell wall GO:0009986 cell surface GO:0030446 hyphal cell wall
Organisms for which functions have been demonstratedCandida albicans
Sequence length248
FASTA sequence>gi|229463024|sp|P82612.3|PMGY_CANAL RecName: Full=Phosphoglycerate mutase; Short=PGAM; AltName: Full=BPG-dependent PGAM; AltName: Full=MPGM; AltName: Full=Phosphoglyceromutase MPKLVLVRHGQSEWNEKNLFTGWVDVRLSETGQKEAKRAGELLKEAGINVDVLHTSKLSRAIQTANIALDAADQLYVPVKRSWRLNERHYGALQGKDKAQTLEAYGQEKFQIWRRSFDVPPPKIDPKDEYSQVGDRRYADVDPAVVPLTESLALVIDRLLPYWQDEIAGDLLAGKVVLIAAHGNSLRALVKHLDNISDEDIAGLNIPTGIPLVYELDENLKPTKPSYYLDPEAAAAGAAAVAAQGQKK
Structure Information
PDB ID
Quaternary structure
Function 1
Function descriptionPhosphoglyceromutase, enzyme 1,3-bisphosphoglycerate <=> 2,3-bisphosphoglycerate Carbohydrate degradation, glycolysis
References for function
E.C. number5.4.2.1
Location of functional site(s)
Cellular location of functioncytoplasm
Comments
Function 2
Function descriptionplasminogen binding
References for functionCrowe, J.D. et al. (2003) Candida albicans binds human plasminogen: identification of eight plasminogen-binding proteins. Mol Microbiol. 2003 Mar;47(6):1637-51. PMID: 12622818
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncell surface
Comments