| General Information |
| MoonProt ID | 101 |
| First appeared in release | 1.0 |
| Name(s) | Triose phosphate isomerase
Triosephosphate isomerase
TIM
Triose-phosphate isomerase
Gene Name: tpiA
|
| UniProt ID | E6J203 (E6J203_STRAP), Unreviewed |
| GO terms | GO:0006094 gluconeogenesis
GO:0006096 glycolysis
GO:0006098 pentose-phosphate shunt
GO:0008152 metabolic process
GO:0003824 catalytic activity
GO:0004807 triose-phosphate isomerase activity
GO:0016853 isomerase activity
GO:0005737 cytoplasm |
| Organisms for which functions have been demonstrated | Streptococcus - oral streptococci (S. anginosus and S. oralis) (Gram positive bacterium) |
| Sequence length | 252 |
| FASTA sequence | >gi|333769664|gb|EGL46762.1| triose-phosphate isomerase [Streptococcus anginosus SK52 = DSM 20563]
MSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSELVEAGIAAPALDLSTVLAAAKGSDLKIAAENCYFEDAGAFTGENSPKVLAEMGTDYVVIGHSERREYFHETDEDINKKAHAIFRNGLLPIICCGESLETYEAGKAVEFVGAQVSAALKGLTAEQVSSLVIAYEPIWAIGTGKSATQDDAQKMCKAVRDVVAADFGQEVADKVRVQYGGSVKPNNVAEYMACPDVDGALVGGASLEAESFLALLDFVK |
| Structure Information |
| PDB ID | closest is Streptococcus with 90% amino acid sequence identity |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-9), and C terminus (aa 252) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Triose phosphate isomerase, enzyme
D-glyceraldehyde 3-phosphate <=> dihydroxyacetone phosphate
Carbohydrate degradation, glycolysis
Carbohydrate biosynthesis, gluconeogenesis
|
| References for function | |
| E.C. number | 5.3.1.1 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | plasminogen binding |
| References for function | Kinnby B, Booth NA, Svensater G. Plasminogen binding by oral streptococci from dental plaque and inflammatory lesions. Microbiology. 2008 Mar;154(Pt 3):924-31. doi: 10.1099/mic.0.2007/013235-0.
PMID: 18310038 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |