| General Information |
| MoonProt ID | 107 |
| First appeared in release | 4.0 |
| Name(s) | NAD biosynthesis/regulator protein NadR |
| UniProt ID | A0A711VCE0 |
| GO terms | GO:0000166 nucleotide binding
GO:0000309 nicotinamide-nucleotide adenylyltransferase activity
GO:0003677 DNA binding
GO:0003824 catalytic activity
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0016740 transferase activity
GO:0016779 nucleotidyltransferase activity
GO:0050262 ribosylnicotinamide kinase activity
GO:0009435 NAD+ biosynthetic process
GO:0019363 pyridine nucleotide biosynthetic process
GO:0005737 cytoplasm
GO:0005886 plasma membrane |
| Organisms for which functions have been demonstrated | Salmonella enterica |
| Sequence length | 410 |
| FASTA sequence | >tr|A0A711VCE0|A0A711VCE0_SALET Trifunctional NAD biosynthesis/regulator protein NadR OS=Salmonella enterica I OX=59201 GN=nadR PE=3 SV=1
MSSFDYLKTAIKQQGCTLQQVADASGMTKGYLSQLLNAKIKSPSAQKLEALHRFLGLEFP
RRQKNIGVVFGKFYPLHTGHIYLIQRACSQVDELHIIMGYDDTRDRGLFEDSAMSQQPTV
SDRLRWLLQTFKYQKNIRIHAFNEEGMEPYPHGWDVWSNGIKAFMAEKGIQPSWIYTSEE
ADAPQYLEHLGIETVLVDPERTFMNISGAQIRENPFRYWEYIPTEVKPFFVRTVAILGGE
SSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDEIALQYSDYDKIALGHAQYIDFAVK
YANKVAFIDTDFVTTQAFCKKYEGHEHPFVQALIDEYRFDLVILLENNTPWVADGLRSLG
SSVDRKAFQSLLVEMLKENNIEFVHVKEADYDGRFLRCVELVKEMMGEQG |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | ribosylnicotinamide (RN) kinase |
| References for function | Grose JH, Bergthorsson U, Roth JR. Regulation of NAD synthesis by the trifunctional NadR protein of Salmonella enterica. J Bacteriol. 2005 Apr;187(8):2774-82. doi: 10.1128/JB.187.8.2774-2782.2005. PMID: 15805524; PMCID: PMC1070365 |
| E.C. number | 2.7.1.22 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | enzyme, nicotinamide mononucleotide (NMN) adenylyltransferase |
| References for function | Grose JH, Bergthorsson U, Roth JR. Regulation of NAD synthesis by the trifunctional NadR protein of Salmonella enterica. J Bacteriol. 2005 Apr;187(8):2774-82. doi: 10.1128/JB.187.8.2774-2782.2005. PMID: 15805524; PMCID: PMC1070365 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |