| General Information |
| MoonProt ID | 123 |
| First appeared in release | 1.0 |
| Name(s) | Lactose synthase
Beta-1,4-galactosyltransferase 1
Beta4Gal-T1
GGTB2
Beta-1,4-GalTase 1
b4Gal-T1
UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 1
UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 1
Gene Name: B4GALT1
|
| UniProt ID | P15291 (B4GT1_HUMAN) Reviewed |
| GO terms | GO:0002064 epithelial cell development
GO:0002064 epithelial cell development
GO:0005975 carbohydrate metabolic process
GO:0005989 lactose biosynthetic process
GO:0006012 galactose metabolic process
GO:0006486 protein glycosylation
GO:0006487 protein N-linked glycosylation
GO:0007155 cell adhesion
GO:0007219 Notch signaling pathway
GO:0007338 single fertilization
GO:0007339 binding of sperm to zona pellucida
GO:0007341 penetration of zona pellucida
GO:0008285 negative regulation of cell proliferation
GO:0009101 glycoprotein biosynthetic process
GO:0009312 oligosaccharide biosynthetic process
GO:0018146 keratan sulfate biosynthetic process
GO:0018279 protein N-linked glycosylation via asparagine
GO:0030198 extracellular matrix organization
GO:0030203 glycosaminoglycan metabolic process
GO:0030879 mammary gland development
GO:0032504 multicellular organism reproduction
GO:0042060 wound healing
GO:0042127 regulation of cell proliferation
GO:0042339 keratan sulfate metabolic process
GO:0043065 positive regulation of apoptotic process
GO:0043687 post-translational protein modification
GO:0044267 cellular protein metabolic process
GO:0044281 small molecule metabolic process
GO:0045136 development of secondary sexual characteristics GO:0048754 branching morphogenesis of an epithelial tube
GO:0050900 leukocyte migration
GO:0051270 regulation of cellular component movement
GO:0060046 regulation of acrosome reaction
GO:0060054 positive regulation of epithelial cell proliferation involved in wound healing
GO:0060055 angiogenesis involved in wound healing
GO:0060058 positive regulation of apoptotic process involved in mammary gland involution
GO:0003831 beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase activity
GO:0003945 N-acetyllactosamine synthase activity
GO:0004461 lactose synthase activity
GO:0008092 cytoskeletal protein binding
GO:0008378 galactosyltransferase activity
GO:0016740 transferase activity
GO:0016757 transferase activity, transferring glycosyl groups GO:0030145 manganese ion binding
GO:0035250 UDP-galactosyltransferase activity
GO:0042803 protein homodimerization activity
GO:0043014 alpha-tubulin binding
GO:0046872 metal ion binding
GO:0048487 beta-tubulin binding
GO:0000138 Golgi trans cisterna
GO:0000139 Golgi membrane
GO:0005576 extracellular region
GO:0005794 Golgi apparatus
GO:0005886 plasma membrane
GO:0009897 external side of plasma membrane
GO:0009986 cell surface
GO:0016020 membrane
GO:0016021 integral component of membrane
GO:0016323 basolateral plasma membrane
GO:0030057 desmosome
GO:0030112 glycocalyx
GO:0031526 brush border membrane
GO:0032580 Golgi cisterna membrane
GO:0070062 extracellular vesicular exosome
|
| Organisms for which functions have been demonstrated | Homo sapiens (human, a mammal, P15291 OMIM number 137060 607091, Congenital disorder of glycosylation, type IId) |
| Sequence length | 398 |
| FASTA sequence | >sp|P15291|B4GT1_HUMAN Beta-1,4-galactosyltransferase 1 OS=Homo sapiens GN=B4GALT1 PE=1 SV=5
MRLREPLLSGSAAMPGASLQRACRLLVAVCALHLGVTLVYYLAGRDLSRLPQLVGVSTPLQGGSNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS
|
| Structure Information |
| PDB ID | 4L41
2AE7 |
| Quaternary structure | |
| SCOP | Nucleotide-diphospho-sugar transferases |
| CATH | 3.90.550.10 |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-6), middle region (aa 65-117, 339-360), and C terminus (aa 393-398) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Lactose synthase, enzyme
UDP-alpha-D-galactose + D-glucose <=> UDP + lactose |
| References for function | Brew K, Vanaman TC, Hill RL. The role of alpha-lactalbumin and the A protein in lactose synthetase: a unique mechanism for the control of a biological reaction. Proc Natl Acad Sci U S A. 1968 Feb. PMID: 5238979 |
| E.C. number | 2.4.1.22 |
| Location of functional site(s) | |
| Cellular location of function | Golgi Complex |
| Comments | |
| Function 2 |
| Function description | Galactosyltransferase, enzyme
UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 1 |
| References for function | MengleGaw L, McCoyHaman MF, Tiemeier DC. Genomic structure and expression of human beta-1,4-galactosyltransferase. Biochem Biophys Res Commun. 1991 May 15. PMID: 1903938 |
| E.C. number | 2.4.1.38 |
| Location of functional site(s) | |
| Cellular location of function | Golgi compartment |
| Comments | |