| General Information |
| MoonProt ID | 145 |
| First appeared in release | 1.0 |
| Name(s) | glutamate racemase
Gene Name: murI |
| UniProt ID | P9WPW9 |
| GO terms | GO:0006807 nitrogen compound metabolic process
GO:0008152 metabolic process
GO:0008360 regulation of cell shape
GO:0009252 peptidoglycan biosynthetic process
GO:0008881 glutamate racemase activity
GO:0016853 isomerase activity
GO:0016855 racemase and epimerase activity, acting on amino acids and derivatives
GO:0036361 racemase activity, acting on amino acids and derivatives |
| Organisms for which functions have been demonstrated | Mycobacterium tuberculosis (mycobacterium, causes tuberculosis) |
| Sequence length | 271 |
| FASTA sequence | >sp|P9WPW9|MURI_MYCTU Glutamate racemase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=murI PE=1 SV=1
MNSPLAPVGVFDSGVGGLTVARAIIDQLPDEDIVYVGDTGNGPYGPLTIPEIRAHALAIG
DDLVGRGVKALVIACNSASSACLRDARERYQVPVVEVILPAVRRAVAATRNGRIGVIGTR
ATITSHAYQDAFAAARDTEITAVACPRFVDFVERGVTSGRQVLGLAQGYLEPLQRAEVDT
LVLGCTHYPLLSGLIQLAMGENVTLVSSAEETAKEVVRVLTEIDLLRPHDAPPATRIFEA
TGDPEAFTKLAARFLGPVLGGVQPVHPSRIH |
| Structure Information |
| PDB ID | 5HJ7 |
| Quaternary structure | |
| SCOP | NA |
| CATH | 3.40.50.1860 |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1 to 3, 268-271 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | glutamate racemase
L-glutamate <=> D-glutamate
Cell wall biogenesis, peptidoglycan biosynthesis |
| References for function | |
| E.C. number | 5.1.1.3 |
| Location of functional site(s) | |
| Cellular location of function | |
| Comments | |
| Function 2 |
| Function description | DNA gyrase
relieves strain when double-stranded DNA is being unwound |
| References for function | Ashiuchi M, Kuwana E, Komatsu K, Soda K, Misono H. Differences in effects on DNA gyrase activity between two glutamate racemases of Bacillus subtilis, the poly-gamma-glutamate synthesis-linking Glr enzyme and the YrpC (MurI) isozyme. FEMS Microbiol Lett. 2003 Jun 27. PMID: 12829290.
Ashiuchi M, Kuwana E, Yamamoto T, Komatsu K, Soda K, Misono H. Glutamate racemase is an endogenous DNA gyrase inhibitor. J Biol Chem. 2002 Oct 18. PMID: 12213801. |
| E.C. number | 5.99.1 |
| Location of functional site(s) | |
| Cellular location of function | with DNA |
| Comments | |