General Information |
MoonProt ID | 165 |
First appeared in release | 1.0 |
Name(s) | High mobility group protein B1
Amphoterin
Heparin-binding protein p30
High mobility group protein 1
HMG-1
Gene Name:Hmgb1 |
UniProt ID | P63159 (HMGB1_RAT), Reviewed |
GO terms | GO:0000902 cell morphogenesis
GO:0002053 positive regulation of mesenchymal cell proliferation GO:0006935 chemotaxis
GO:0007399 nervous system development
GO:0007623 circadian rhythm
GO:0008156 negative regulation of DNA replication
GO:0008284 positive regulation of cell proliferation
GO:0009408 response to heat
GO:0009749 response to glucose
GO:0010942 positive regulation of cell death
GO:0010976 positive regulation of neuron projection development GO:0014911 positive regulation of smooth muscle cell migration GO:0030335 positive regulation of cell migration
GO:0031175 neuron projection development
GO:0031532 actin cytoskeleton reorganization
GO:0032392 DNA geometric change
GO:0032496 response to lipopolysaccharide
GO:0032868 response to insulin
GO:0000400 four-way junction DNA binding
GO:0000401 open form four-way junction DNA binding
GO:0000402 crossed form four-way junction DNA binding
GO:0003677 DNA binding
GO:0003681 bent DNA binding
GO:0003690 double-stranded DNA binding
GO:0003697 single-stranded DNA binding
GO:0005125 cytokine activity
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0008134 transcription factor binding
GO:0008201 heparin binding
GO:0008301 DNA binding, bending
GO:0042277 peptide binding
GO:0046983 protein dimerization activity
GO:0050786 RAGE receptor binding
GO:0051861 glycolipid binding
GO:0033034 positive regulation of myeloid cell apoptotic process
GO:0034341 response to interferon-gamma
GO:0042493 response to drug
GO:0043065 positive regulation of apoptotic process
GO:0045663 positive regulation of myoblast differentiation GO:0045931 positive regulation of mitotic cell cycle
GO:0050727 regulation of inflammatory response
GO:0050831 male-specific defense response to bacterium
GO:0050930 induction of positive chemotaxis
GO:0051450 myoblast proliferation
GO:0071347 cellular response to interleukin-1
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005737 cytoplasm |
Organisms for which functions have been demonstrated | Rattus norvegicus (Rat, a mammal) |
Sequence length | 215 |
FASTA sequence | >sp|P63159|HMGB1_RAT High mobility group protein B1 OS=Rattus norvegicus GN=Hmgb1 PE=1 SV=2
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE
|
Structure Information |
PDB ID | 2YRQ,
2RTU |
Quaternary structure | |
SCOP | NA |
CATH | 1.10.30.10 |
TM Helix Prediction | no TM helices |
DisProt Annotation | 35.81%, 73 - 99; 165 - 184; 184 - 214, |
Predicted Disorder Regions | 1 to 9, 80-91, 166-215 |
Connections to Disease |
OMIM ID | |
Function 1 |
Function description | binds heparin
involved in extension of neurite-type cytoplasmic processes |
References for function | Merenmies J, Pihlaskari R, Laitinen J, Wartiovaara J, Rauvala H. 30-kDa heparin-binding protein of brain (amphoterin) involved in neurite outgrowth. Amino acid sequence and localization in the filopodia of the advancing plasma membrane. J Biol Chem. 1991 Sep 5. PMID: 1885601 |
E.C. number | N/A |
Location of functional site(s) | |
Cellular location of function | cytoplasm |
Comments | |
Function 2 |
Function description | DNA binding protein, without sequence specificity
associates with chromatin, may play structural role
bends DNA |
References for function | Hardman CH, Broadhurst RW, Raine AR, Grasser KD, Thomas JO, Laue ED. Structure of the A-domain of HMG1 and its interaction with DNA as studied by heteronuclear three- and four-dimensional NMR spectroscopy. Biochemistry. 1995 Dec 26. PMID: 8527432 |
E.C. number | N/A |
Location of functional site(s) | |
Cellular location of function | nucleus |
Comments | |