| General Information |
| MoonProt ID | 175 |
| First appeared in release | 1.0 |
| Name(s) | RACK1
Guanine nucleotide-binding protein subunit beta-like protein
Receptor for activated C kinase
Receptor of activated protein kinase C 1
Gene Name: ASC1 |
| UniProt ID | P38011 (GBLP_YEAST), Reviewed |
| GO terms | GO:0001403 invasive growth in response to glucose limitation GO:0007186 G-protein coupled receptor signaling pathway
GO:0010255 glucose mediated signaling pathway
GO:0017148 negative regulation of translation
GO:0050790 regulation of catalytic activity
GO:0001965 G-protein alpha-subunit binding
GO:0004871 signal transducer activity
GO:0005092 GDP-dissociation inhibitor activity
GO:0005737 cytoplasm
GO:0022627 cytosolic small ribosomal subunit |
| Organisms for which functions have been demonstrated | Saccharomyces cerevisiae (yeast, fungi) |
| Sequence length | 319 |
| FASTA sequence | >sp|P38011|GBLP_YEAST Guanine nucleotide-binding protein subunit beta-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASC1 PE=1 SV=4
MASNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRYWLAAATATGIKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRVWQVMTAN
|
| Structure Information |
| PDB ID | 3IZB, 3O2Z, 3O30, 3U5C, 3U5G, 4BYL, 4BYT, 3RFG, 3RFH, 1TRJ, 3JYV, 3FRX, |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-7), and C terminus (aa 316-319) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Component of the 40S (small) ribosomal subunit |
| References for function | Sengupta J, Nilsson J, Gursky R, Spahn CM, Nissen P, Frank J. Identification of the versatile scaffold protein RACK1 on the eukaryotic ribosome by cryo-EM. Nat Struct Mol Biol. 2004 Oct. PMID: 15334071 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm, part of the ribosome |
| Comments | |
| Function 2 |
| Function description | scaffold in cytoplasmic signal transduction pathways |
| References for function | Kadrmas JL, Smith MA, Pronovost SM, Beckerle MC. Characterization of RACK1 function in Drosophila development. Dev Dyn. 2007 Aug. PMID: 17584887 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |