| General Information |
| MoonProt ID | 178 |
| First appeared in release | 1.0 |
| Name(s) | 60S ribosomal protein L30
L32
RP73
YL38
RPL32
Gene Name: RPL30
|
| UniProt ID | P14120 (RL30_YEAST), Reviewed |
| GO terms | GO:0002181 cytoplasmic translation
GO:0006364 rRNA processing
GO:0006412 translation
GO:0017148 negative regulation of translation
GO:0048025 negative regulation of mRNA splicing, via spliceosome
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0030627 pre-mRNA 5'-splice site binding
GO:0005622 intracellular
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0030529 ribonucleoprotein complex |
| Organisms for which functions have been demonstrated | Saccharomyces cerevisiae (yeast, fungi) |
| Sequence length | 105 |
| FASTA sequence | >sp|P14120|RL30_YEAST 60S ribosomal protein L30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL30 PE=1 SV=3
MAPVKSQESINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEYYAMLSKTKVYYFQGGNNELGTAVGKLFRVGVVSILEAGDSDILTTLA
|
| Structure Information |
| PDB ID | 1T0K, 3IZS, 3O58, 3O5H, 3U5E, 3U5I, 4B6A, 1CK2, 1CN7, 1NMU, 4BYN, 4BYU, 3JYW |
| Quaternary structure | |
| SCOP | Knottins (small inhibitors, toxins, lectins) |
| CATH | 3.30.30.10 |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-6), and C terminus (aa 103-105) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Component of the ribosome large subunit (60S) |
| References for function | |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm, part of the ribosome |
| Comments | |
| Function 2 |
| Function description | inhibits the splicing of the transcript of its own gene, RPL32 |
| References for function | Eng FJ, Warner JR. Structural basis for the regulation of splicing of a yeast messenger RNA. Cell. 1991 May 31. PMID: 2040015 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |