| General Information |
| MoonProt ID | 191 |
| First appeared in release | 1.0 |
| Name(s) | 60S ribosomal protein L10-1
Gene Name:RPL10A |
| UniProt ID | Q93VT9 (RL101_ARATH), Reviewed |
| GO terms | GO:0001510 RNA methylation
GO:0006412 translation
GO:0006952 defense response
GO:0032502 developmental process
GO:0071493 cellular response to UV-B
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0005622 intracellular
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005773 vacuole
GO:0005774 vacuolar membrane
GO:0005829 cytosol
GO:0005840 ribosome
GO:0009507 chloroplast
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0030529 ribonucleoprotein complex
GO:0005794 Golgi apparatus |
| Organisms for which functions have been demonstrated | Arabidopsis thaliana (Mouse-ear cress, a plant) |
| Sequence length | 220 |
| FASTA sequence | >sp|Q93VT9|RL101_ARATH 60S ribosomal protein L10-1 OS=Arabidopsis thaliana GN=RPL10A PE=1 SV=1
MGRRPARCYRQIKGKPYPKSRYCRGVPDPKIRIYDVGMKRKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMVKSAGKDAFHLRIRVHPFHVLRINKMLSCAGADRLQTGMRGAFGKALGTCARVAIGQVLLSVRCKDAHGHHAQEALRRAKFKFPGRQKIIVSRKWGFTKFNRADFTKLRQEKRVVPDGVNAKFLSCHGPLANRQPGSAFLPAHY
|
| Structure Information |
| PDB ID | Closest homologue in PDB is from Triticum aestivum with 83.80% amino acid sequence identity; 98% query cover |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1 to 6, 212-220 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | ribosomal protein, part of 40S subunit
|
| References for function | |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm, part of ribosome |
| Comments | |
| Function 2 |
| Function description | Involved in NSP-interacting kinase (NIK) receptor-mediated defense pathway to defend against geminivirus
substrate and binding partner of NIK1
|
| References for function | Carvalho CM, Santos AA, Pires SR, Rocha CS, Saraiva DI, Machado JP, Mattos EC, Fietto LG, Fontes EP. Regulated nuclear trafficking of rpL10A mediated by NIK1 represents a defense strategy of plant cells against virus. PLoS Pathog. 2008 Dec. PMID: 19112492 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | nucleos |
| Comments | |