| General Information |
| MoonProt ID | 205 |
| First appeared in release | 1.0 |
| Name(s) | Cysteine synthase A
CSase
O-acetylserine (thiol)-lyase
OAS-TL
Superoxide-inducible protein 11
SOI11
Gene Name:cysK |
| UniProt ID | P37887 (CYSK_BACSU), Reviewed |
| GO terms | GO:0006535 cysteine biosynthetic process from serine
GO:0008652 cellular amino acid biosynthetic process
GO:0019344 cysteine biosynthetic process
GO:0004124 cysteine synthase activity
GO:0016740 transferase activity |
| Organisms for which functions have been demonstrated | Bacillus subtilis |
| Sequence length | 308 |
| FASTA sequence | >sp|P37887|CYSK_BACSU Cysteine synthase OS=Bacillus subtilis (strain 168) GN=cysK PE=1 SV=3
MVRVANSITELIGNTPIVKLNRLADENSADVYLKLEYMNPGSSVKDRIGLAMIEAAEKEGKLKAGNTIIEPTSGNTGIGLAMVAAAKGLKAILVMPDTMSMERRNLLRAYGAELVLTPGAEGMKGAIKKAEELAEKHGYFVPQQFNNPSNPEIHRQTTGKEIVEQFGDDQLDAFVAGIGTGGTITGAGEVLKEAYPSIKIYAVEPSDSPVLSGGKPGPHKIQGIGAGFVPDILNTEVYDEIFPVKNEEAFEYARRAAREEGILGGISSGAAIYAALQVAKKLGKGKKVLAIIPSNGERYLSTPLYQFD
|
| Structure Information |
| PDB ID | |
| Quaternary structure | |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-4), middle regions (aa 139-163, 211-216), and C terminus (aa 303-308) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Cysteine synthase, enzyme
O-acetyl-serine + H2S = cysteine + acetate
Amino-acid biosynthesis, biosynthesis of cysteine |
| References for function | Hullo MF1, Auger S, Soutourina O, Barzu O, Yvon M, Danchin A, Martin-Verstraete I. Conversion of methionine to cysteine in Bacillus subtilis and its regulation.J Bacteriol. 2007 Jan;189(1):187-97.
PMID: 17056751
|
| E.C. number | 2.5.1.47 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | transcriptional regulator
regulates activity of CymR transcription factor
forms complex with CymR that represses transcription of the CymR regulon
|
| References for function | Tanous C, Soutourina O, Raynal B, Hullo MF, Mervelet P, Gilles AM, Noirot P, Danchin A, England P, MartinVerstraete I. The CymR regulator in complex with the enzyme CysK controls cysteine metabolism in Bacillus subtilis. J Biol Chem. 2008 Dec 19. PMID: 18974048
Hullo MF, Auger S, Soutourina O, Barzu O, Yvon M, Danchin A, MartinVerstraete I. Conversion of methionine to cysteine in Bacillus subtilis and its regulation. J Bacteriol. 2007 Jan. PMID: 17056751 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |