| General Information |
| MoonProt ID | 213 |
| First appeared in release | 1.0 |
| Name(s) | dihydroxyacetone kinase
PTS-dependent dihydroxyacetone kinase, ADP-binding subunit DhaL
Gene Name:dhaL
|
| UniProt ID | P76014 (DHAL_ECOLI), Reviewed |
| GO terms | GO:0006071 glycerol metabolic process
GO:0016310 phosphorylation
GO:0019563 glycerol catabolic process
GO:0000166 nucleotide binding
GO:0000287 magnesium ion binding
GO:0004371 glycerone kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0016740 transferase activity
GO:0016772 transferase activity, transferring phosphorus-containing groups
GO:0043531 ADP binding
contributes_to GO:0016740 transferase activity |
| Organisms for which functions have been demonstrated | Escherichia coli (Gram negative bacterium) |
| Sequence length | 210 |
| FASTA sequence | >sp|P76014|DHAL_ECOLI PTS-dependent dihydroxyacetone kinase, ADP-binding subunit DhaL OS=Escherichia coli (strain K12) GN=dhaL PE=1 SV=3
MSLSRTQIVNWLTRCGDIFSTESEYLTGLDREIGDADHGLNMNRGFSKVVEKLPAIADKDIGFILKNTGMTLLSSVGGASGPLFGTFFIRAAQATQARQSLTLEELYQMFRDGADGVISRGKAEPGDKTMCDVWVPVVESLRQSSEQNLSVPVALEAASSIAESAAQSTITMQARKGRASYLGERSIGHQDPGATSVMFMMQMLALAAKE
|
| Structure Information |
| PDB ID | 2BTD
3PNL
4LRZ |
| Quaternary structure | |
| SCOP | DhaL-like |
| CATH | 1.25.40.340 |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1-3, 207-210 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | subunit of dihydroxyacetone kinase, enzyme
phosphorylates dihydroxyacetone
contains the ADP-binding site
|
| References for function | |
| E.C. number | 2.7.-.- |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | coactivator of DhaR transcription activator
binds to DhaR
affects transcription of the dhaKLM operon
|
| References for function | B?chler C, Schneider P, B?hler P, Lustig A, Erni B. Escherichia coli dihydroxyacetone kinase controls gene expression by binding to transcription factor DhaR. EMBO J. 2005 Jan 26. PMID: 15616579 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |