| General Information |
| MoonProt ID | 243 |
| First appeared in release | 1.0 |
| Name(s) | Multisynthase complex auxiliary component p18
Aminoacyl tRNA synthase complex-interacting multifunctional protein 3 Gene Name: Aimp3 |
| UniProt ID | Q9D1M4 |
| GO terms | |
| Organisms for which functions have been demonstrated | Mus musculus (Mouse, mammal) |
| Sequence length | 174 aa |
| FASTA sequence | >sp|Q9D1M4|MCA3_MOUSE Eukaryotic translation elongation factor 1 epsilon-1 OS=Mus musculus GN=Eef1e1 PE=1 SV=1
MAAAAELRLLEKSLGLKPGNKYSAQGERQIPVLQTNNGPSLMGLSTIATHLVKQASKEHLLGSTAEEKAMVQQWLEFRVTRVDGHSSKEDTQTLLKDLNSYLEDKVYLAGHNITLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPDIRQHLSSIVFIKNRLYANSH
|
| Structure Information |
| PDB ID | |
| Quaternary structure | |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1-10, 169-174 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | scaffold protein in the multisynthase complex forms a multi-protein complex with glutamyl-, prolyl-, isoelucyl-, leucyl-, methionyl-, glutaminyl-, lysyl-, arginyl-, and aspartyl-tRNA synthetases, AIMP2/p38, and AIMP3/p24 |
| References for function | |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | protein-protein interaction with ATM/ATR that results in p53 activation
translocates to nucleus and plays a role in DNA repair
|
| References for function | Park BJ, Kang JW, Lee SW, Choi SJ, Shin YK, Ahn YH, Choi YH, Choi D, Lee KS, Kim S. The haploinsufficient tumor suppressor p18 upregulates p53 via interactions with ATM/ATR. Cell. 2005 Jan 28. PMID: 15680327 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | nucleus |
| Comments | |