| General Information |
| MoonProt ID | 246 |
| First appeared in release | 1.0 |
| Name(s) | 50S ribosomal protein L1
Gene Name: rplA |
| UniProt ID | P0A7L0 (RL1_ECOLI), Reviewed |
| GO terms | GO:0006412 translation
GO:0006417 regulation of translation
GO:0045947 negative regulation of translational initiation
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:0030529 ribonucleoprotein complex |
| Organisms for which functions have been demonstrated | Escherichia coli (Gram negative bacterium) |
| Sequence length | 234 |
| FASTA sequence | >sp|P0A7L0|RL1_ECOLI 50S ribosomal protein L1 OS=Escherichia coli (strain K12) GN=rplA PE=1 SV=2
MAKLTKRMRVIREKVDATKQYDINEAIALLKELATAKFVESVDVAVNLGIDARKSDQNVRGATVLPHGTGRSVRVAVFTQGANAEAAKAAGAELVGMEDLADQIKKGEMNFDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVRYRNDKNGIIHTTIGKVDFDADKLKENLEALLVALKKAKPTQAKGVYIKKVSISTTMGAGVAVDQAGLSASVN
|
| Structure Information |
| PDB ID | 3KCR, 2WWQ, 3IZT, 3IZU, 3J01, 3J0T, 3J0W, 3J0Y, 3J11, 3J12, 3J14, 3J37, 3J46, 3J4X, 3J50, 3J51, 3J52, 3J54, 3J56, 3J58, 3J5A, 3J5C, 3J5E, 3J5G, 3J5I, 3J5K, 3J5S, 3FIK, 3J5U, 3J5W, 2RDO, 2GYC, 2GYA |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-6), middle regions (aa 62), and C terminus (aa 230-234) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | ribosomal protein, part of the 50S subunit
|
| References for function | |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | translational repressor
binds to the mRNA of the L11 operon |
| References for function | Yates JL, Arfsten AE, Nomura M. In vitro expression of Escherichia coli ribosomal protein genes: autogenous inhibition of translation. Proc Natl Acad Sci U S A. 1980 Apr. PMID: 6445562 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |