| General Information |
| MoonProt ID | 258 |
| First appeared in release | 1.0 |
| Name(s) | Peptidyl-tRNA hydrolase 2, mitochondrial
PTH 2
Bcl-2 inhibitor of transcription 1
Gene Name:PTRH2 |
| UniProt ID | Q9Y3E5 (PTH2_HUMAN), Reviewed |
| GO terms | GO:0006915 apoptotic process
GO:0008152 metabolic process
GO:0010629 negative regulation of gene expression
GO:2000210 positive regulation of anoikis
GO:2000811 negative regulation of anoikis
GO:0004045 aminoacyl-tRNA hydrolase activity
GO:0005515 protein binding
GO:0016787 hydrolase activity
GO:0005739 mitochondrion
GO:0005829 cytosol |
| Organisms for which functions have been demonstrated | Homo sapiens (human, a mammal) |
| Sequence length | 179 |
| FASTA sequence | >sp|Q9Y3E5|PTH2_HUMAN Peptidyl-tRNA hydrolase 2, mitochondrial OS=Homo sapiens GN=PTRH2 PE=1 SV=1
MPSKSLVMEYLAHPSTLGLAVGVACGMCLGWSLRVCFGMLPKSKTSKTHTDTESEASILGDSGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY
|
| Structure Information |
| PDB ID | 1Q7S |
| Quaternary structure | |
| SCOP | NA |
| CATH | 3.40.1490.10 |
| TM Helix Prediction | (15-37)mitochondrian transport peptide |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1-9, 42-57 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Peptidyl-tRNA hydrolase, enzyme
aminoacyl-tRNA + H2O => amino acid + tRNA
releases tRNA from the premature translation termination product
|
| References for function | De Pereda, Waas WF, Jan Y, Ruoslahti E, Schimmel P, Pascual J. Crystal structure of a human peptidyl-tRNA hydrolase reveals a new fold and suggests basis for a bifunctional activity. J Biol Chem. 2004 Feb 27;279(9):8111-5.
PMID: 14660562 |
| E.C. number | 3.1.1.29 |
| Location of functional site(s) | |
| Cellular location of function | mitochondrion |
| Comments | |
| Function 2 |
| Function description | inhibitor of transcription
protein-protein interaction |
| References for function | De Pereda, Waas WF, Jan Y, Ruoslahti E, Schimmel P, Pascual J. Crystal structure of a human peptidyl-tRNA hydrolase reveals a new fold and suggests basis for a bifunctional activity. J Biol Chem. 2004 Feb 27;279(9):8111-5.
PMID: 14660562 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | mitochondrion |
| Comments | |