| General Information |
| MoonProt ID | 262 |
| First appeared in release | 1.0 |
| Name(s) | Peroxiredoxin TSA1
Cytoplasmic thiol peroxidase 1
cTPx 1
PRP
Thiol-specific antioxidant protein 1
Thioredoxin peroxidase
Gene Name:TSA1 |
| UniProt ID | P34760 (TSA1_YEAST), Reviewed |
| GO terms | GO:0000077 DNA damage checkpoint
GO:0001302 replicative cell aging
GO:0006457 protein folding
GO:0033194 response to hydroperoxide
GO:0034599 cellular response to oxidative stress
GO:0042262 DNA protection
GO:0045454 cell redox homeostasis
GO:0055114 oxidation-reduction process
GO:0061077 chaperone-mediated protein folding
GO:0004601 peroxidase activity
GO:0008379 thioredoxin peroxidase activity
GO:0016209 antioxidant activity
GO:0016491 oxidoreductase activity
GO:0043022 ribosome binding
GO:0051082 unfolded protein binding
GO:0051920 peroxiredoxin activity
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005844 polysome |
| Organisms for which functions have been demonstrated | Saccharomyces cerevisiae (yeast, fungi) |
| Sequence length | 196 |
| FASTA sequence | >sp|P34760|TSA1_YEAST Peroxiredoxin TSA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TSA1 PE=1 SV=3
MVAQVQKQAPTFKKTAVVDGVFDEVSLDKYKGKYVVLAFIPLAFTFVCPTEIIAFSEAAKKFEEQGAQVLFASTDSEYSLLAWTNIPRKEGGLGPINIPLLADTNHSLSRDYGVLIEEEGVALRGLFIIDPKGVIRHITINDLPVGRNVDEALRLVEAFQWTDKNGTVLPCNWTPGAATIKPTVEDSKEYFEAANK
|
| Structure Information |
| PDB ID | 3SBC |
| Quaternary structure | |
| SCOP | NA |
| CATH | 3.40.30.10 |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1-4, 192-196 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | peroxiredoxin
peroxidase
antioxidant
2 R'-SH + ROOH => R'-S-S-R' + H2O + ROH.
|
| References for function | |
| E.C. number | 1.11.1.15 |
| Location of functional site(s) | |
| Cellular location of function | cytooplasm |
| Comments | |
| Function 2 |
| Function description | molecular chaperones
helps proteins fold |
| References for function | Jang HH, Lee KO, Chi YH, Jung BG, Park SK, Park JH, Lee JR, Lee SS, Moon JC, Yun JW, Choi YO, Kim WY, Kang JS, Cheong GW, Yun DJ, Rhee SG, Cho MJ, Lee SY. Two enzymes in one; two yeast peroxiredoxins display oxidative stress-dependent switching from a peroxidase to a molecular chaperone function. Cell. 2004 May 28;117(5):625-35.
PMID: 15163410 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |