General Information |
MoonProt ID | 265 |
First appeared in release | 1.0 |
Name(s) | Vacuolar protein-sorting-associated protein 25
ESCRT-II complex subunit VPS25
Vacuolar protein sorting 25
Gene Name: Vps25 |
UniProt ID | Q7JXV9 (VPS25_DROME), Reviewed |
GO terms | GO:0000046 autophagic vacuole fusion
GO:0006810 transport
GO:0008283 cell proliferation
GO:0008593 regulation of Notch signaling pathway
GO:0010669 epithelial structure maintenance
GO:0015031 protein transport
GO:0016197 endosomal transport
GO:0030154 cell differentiation
GO:0032509 endosome transport via multivesicular body sorting pathway
GO:0042059 negative regulation of epidermal growth factor receptor signaling pathway
GO:0042981 regulation of apoptotic process
GO:0043162 ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0045199 maintenance of epithelial cell apical/basal polarity
GO:0048803 imaginal disc-derived male genitalia morphogenesis
GO:0050680 negative regulation of epithelial cell proliferation
GO:0000814 ESCRT II complex
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0010008 endosome membrane
GO:0016020 membrane |
Organisms for which functions have been demonstrated | Drosophila melanogaster (fruit fly, an insect) |
Sequence length | 174 |
FASTA sequence | >sp|Q7JXV9|VPS25_DROME Vacuolar protein-sorting-associated protein 25 OS=Drosophila melanogaster GN=Vps25 PE=2 SV=1
MAEFQWPWEYTFPPFFTLQPHEETRQQQLKVWTDLFLKYLRHTNRFTLSIGDQNSPLFHNEALKRRLSPELVLAILGELERSGHANPLDKRRQEWQVYWFTLEEYGNMVYDWVQETGQTNTICTLYEIASGENTSHLDFYGVDEAVLLSALRLLEEKGRCELIEMDGSHGVKFF
|
Structure Information |
PDB ID | None, closest homologue is different species, 43.02% Chain C, Vacuolar Protein-sorting-associated Protein 25 [Homo sapiens] 3CUQ |
Quaternary structure | |
SCOP | NA |
CATH | NA |
TM Helix Prediction | no TM helices |
DisProt Annotation | Not in DisProt |
Predicted Disorder Regions | 1-3 |
Connections to Disease |
OMIM ID | |
Function 1 |
Function description | Component of the ESCRT-II complex (ensodomal sorting complex required for transport II)
complex needed for sorting ubiquitinated endosomal proteins into multivesicular bodies
important for transport of transmembrane proteins to the lysosome for degradation |
References for function | |
E.C. number | N/A |
Location of functional site(s) | |
Cellular location of function | cytoplasm, endosomal membrane |
Comments | |
Function 2 |
Function description | with other members of the ESCRT complex, binds to the localization element in the 3' untranslated region (UTR) of bicoid mRNA
functions in localizing bicoid mRNA to the anterior of the Drosophila egg |
References for function | Irion U, St Johnston. bicoid RNA localization requires specific binding of an endosomal sorting complex. Nature. 2007 Feb 1. PMID: 17268469 |
E.C. number | N/A |
Location of functional site(s) | |
Cellular location of function | cytoplasm |
Comments | |