| General Information |
| MoonProt ID | 275 |
| First appeared in release | 1.0 |
| Name(s) | Gpx4
Phospholipid hydroperoxide glutathione peroxidase, mitochondrial
PHGPx
Glutathione peroxidase 4
GPx-4
GSHPx-4
Gene Name:GPX4 |
| UniProt ID | P36969 (GPX4_HUMAN), Reviewed |
| GO terms | GO:0006325 chromatin organization
GO:0006644 phospholipid metabolic process
GO:0006749 glutathione metabolic process
GO:0006979 response to oxidative stress
GO:0007275 multicellular organismal development
GO:0007283 spermatogenesis
GO:0007568 aging
GO:0019369 arachidonic acid metabolic process
GO:0019372 lipoxygenase pathway
GO:0032355 response to estradiol
GO:0042744 hydrogen peroxide catabolic process
GO:0044281 small molecule metabolic process
GO:0050727 regulation of inflammatory response
GO:0055114 oxidation-reduction process
GO:0004601 peroxidase activity
GO:0004602 glutathione peroxidase activity
GO:0008430 selenium binding
GO:0016491 oxidoreductase activity
GO:0043295 glutathione binding
GO:0047066 phospholipid-hydroperoxide glutathione peroxidase activity
GO:0005634 nucleus
GO:0005635 nuclear envelope
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005829 cytosol
GO:0070062 extracellular vesicular exosome |
| Organisms for which functions have been demonstrated | Homo sapiens (human, a mammal, OMIM number 138322 Spondylometaphyseal dysplasia) |
| Sequence length | 197 |
| FASTA sequence | >sp|P36969|GPX4_HUMAN Phospholipid hydroperoxide glutathione peroxidase, mitochondrial OS=Homo sapiens GN=GPX4 PE=1 SV=3
MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF
|
| Structure Information |
| PDB ID | 2OBI,
3GS3 |
| Quaternary structure | |
| SCOP | Thioredoxin fold |
| CATH | 3.40.30.10 |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1-8, 30-31 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Phospholipid hydroperoxide glutathione peroxidase, enzyme
removes membrane lipid peroxidation, cell protection
2 glutathione + a lipid hydroperoxide => glutathione disulfide + lipid + 2 H2O |
| References for function | NA |
| E.C. number | 1.11.1.12 |
| Location of functional site(s) | |
| Cellular location of function | mitochondrion |
| Comments | |
| Function 2 |
| Function description | structural role in capsule in mature spermatozoa
|
| References for function | Scheerer P, Borchert A, Krauss N, Wessner H, Gerth C, H?hne W, Kuhn H. Structural basis for catalytic activity and enzyme polymerization of phospholipid hydroperoxide glutathione peroxidase-4 (GPx4). Biochemistry. 2007 Aug 7;46(31):9041-9.
PMID: 17630701 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | spermatozoa capsule |
| Comments | |