| General Information |
| MoonProt ID | 277 |
| First appeared in release | 1.0 |
| Name(s) | Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial
Isocitric dehydrogenase
NAD(+)-specific ICDH
Gene Name: IDH1 |
| UniProt ID | P28834 (IDH1_YEAST), Reviewed |
| GO terms | GO:0006099 tricarboxylic acid cycle
GO:0006102 isocitrate metabolic process
GO:0006537 glutamate biosynthetic process
GO:0008152 metabolic process
GO:0055114 oxidation-reduction process
GO:0000287 magnesium ion binding
GO:0003723 RNA binding
GO:0003824 catalytic activity
GO:0004449 isocitrate dehydrogenase (NAD+) activity
GO:0005515 protein binding
GO:0016491 oxidoreductase activity
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0046872 metal ion binding
GO:0051287 NAD binding
GO:0004449 isocitrate dehydrogenase (NAD+) activity
GO:0005739 mitochondrion
GO:0005758 mitochondrial intermembrane space
GO:0005759 mitochondrial matrix
GO:0005829 cytosol
GO:0005962 mitochondrial isocitrate dehydrogenase complex (NAD+)
GO:0042645 mitochondrial nucleoid |
| Organisms for which functions have been demonstrated | Saccharomyces cerevisiae (yeast, fungi) |
| Sequence length | 360 |
| FASTA sequence | >sp|P28834|IDH1_YEAST Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IDH1 PE=1 SV=2
MLNRTIAKRTLATAAQAERTLPKKYGGRFTVTLIPGDGVGKEITDSVRTIFEAENIPIDWETINIKQTDHKEGVYEAVESLKRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPGVVESLKVMTRPKTERIARFAFDFAKKYNRKSVTAVHKANIMKLGDGLFRNIITEIGQKEYPDIDVSSIIVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLMLNHLGLNEYATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEIINKLSTM
|
| Structure Information |
| PDB ID | 3BLW,
3BLX,
3BLV |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1-18, 360 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Isocitrate dehydrogenase, enzyme
Isocitrate + NAD+ = 2-oxoglutarate + CO2 + NADH
Citric acid cycle |
| References for function | |
| E.C. number | 1.1.1.41 |
| Location of functional site(s) | |
| Cellular location of function | mitochondrion |
| Comments | |
| Function 2 |
| Function description | binds mRNA
binds specifically to 5'-untranslated leaders of mitochondrial mRNAs |
| References for function | Elzinga SD, Bednarz AL, van Oosterum, Dekker PJ, Grivell LA. Yeast mitochondrial NAD(+)-dependent isocitrate dehydrogenase is an RNA-binding protein. Nucleic Acids Res. 1993 Nov 25. PMID: 7505425 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | mitochondrion |
| Comments | |