General Information |
MoonProt ID | 286 |
First appeared in release | 1.0 |
Name(s) | Matrix metaloproteinase 12
Macrophage metalloelastase
MME
MMP-12
Gene Name:Mmp12 |
UniProt ID | P34960 (MMP12_MOUSE), Reviewed |
GO terms | GO:0006508 proteolysis
GO:0042060 wound healing
GO:0004222 metalloendopeptidase activity
GO:0005509 calcium ion binding
GO:0008233 peptidase activity
GO:0008237 metallopeptidase activity
GO:0008270 zinc ion binding
GO:0016787 hydrolase activity
GO:0046872 metal ion binding
GO:0005576 extracellular region
GO:0005578 proteinaceous extracellular matrix
GO:0031012 extracellular matrix |
Organisms for which functions have been demonstrated | Mus musculus (Mouse, mammal) |
Sequence length | 473 |
FASTA sequence | >sp|P34960|MMP12_MOUSE Macrophage metalloelastase OS=Mus musculus GN=Mmp12 PE=1 SV=3
MSCTLLKGVCTMKFLMMIVFLQVSACGAAPMNDSEFAEWYLSRFYDYGKDRIPMTKTKTNRNFLKEKLQEMQQFFGLEATGQLDNSTLAIMHIPRCGVPDVQHLRAVPQRSRWMKRYLTYRIYNYTPDMKREDVDYIFQKAFQVWSDVTPLRFRKLHKDEADIMILFAFGAHGDFNYFDGKGGTLAHAFYPGPGIQGDAHFDEAETWTKSFQGTNLFLVAVHELGHSLGLQHSNNPKSIMYPTYRYLNPSTFRLSADDIRNIQSLYGAPVKPPSLTKPSSPPSTFCHQSLSFDAVTTVGEKIFFFKDWFFWWKLPGSPATNITSISSIWPSIPSGIQAAYEIESRNQLFLFKDEKYWLINNLVPEPHYPRSIYSLGFSASVKKVDAAVFDPLRQKVYFFVDKHYWRYDVRQELMDPAYPKLISTHFPGIKPKIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLKSTSWFGC
|
Structure Information |
PDB ID | None, closest homologue is 79.82% Chain q, 60s Acidic Ribosomal Protein P0 [Drosophila melanogaster] 3J39 |
Quaternary structure | |
SCOP | NA |
CATH | NA |
TM Helix Prediction | no TM helices |
DisProt Annotation | Not in DisProt |
Predicted Disorder Regions | 1-8, 52-61, 273-281 |
Connections to Disease |
OMIM ID | |
Function 1 |
Function description | Matrix metaloproteinase, enzyme
cleaves elastin, IFN-? |
References for function | Marchant DJ, Bellac CL, Moraes TJ, Wadsworth SJ, Dufour A, Butler GS, Bilawchuk LM, Hendry RG, Robertson AG, Cheung CT, Ng J, Ang L, Luo Z, Heilbron K, Norris MJ, Duan W, Bucyk T, Karpov A, Devel L, Georgiadis D, Hegele RG, Luo H, Granville DJ, Dive V, McManus BM, Overall CM. A new transcriptional role for matrix metalloproteinase-12 in antiviral immunity. Nat Med. 2014 May;20(5):493-502. doi: 10.1038/nm.3508.
PMID: 24784232 |
E.C. number | 3.4.24.65 |
Location of functional site(s) | |
Cellular location of function | extracellular |
Comments | |
Function 2 |
Function description | promotes transcription
binds to the NFKBIA promoter
|
References for function | Marchant DJ, Bellac CL, Moraes TJ, Wadsworth SJ, Dufour A, Butler GS, Bilawchuk LM, Hendry RG, Robertson AG, Cheung CT, Ng J, Ang L, Luo Z, Heilbron K, Norris MJ, Duan W, Bucyk T, Karpov A, Devel L, Georgiadis D, Hegele RG, Luo H, Granville DJ, Dive V, McManus BM, Overall CM. A new transcriptional role for matrix metalloproteinase-12 in antiviral immunity. Nat Med. 2014 May;20(5):493-502. doi: 10.1038/nm.3508.
PMID: 24784232 |
E.C. number | N/A |
Location of functional site(s) | |
Cellular location of function | nucleus |
Comments | |