Protein Information

General Information
MoonProt ID310
First appeared in release2.0
Name(s)beta-arrestin 1, Beta-arrestin-1 Gene: ARRB1
UniProt IDP49407 (ARRB1_HUMAN)
GO termsGO:0000187 activation of MAPK activity GO:0001933 negative regulation of protein phosphorylation GO:0001934 positive regulation of protein phosphorylation GO:0002031 G-protein coupled receptor internalization GO:0002092 positive regulation of receptor internalization GO:0006351 transcription, DNA-templated GO:0006355 regulation of transcription, DNA-templated GO:0006366 transcription from RNA polymerase II promoter GO:0006810 transport GO:0006897 endocytosis GO:0007165 signal transduction GO:0007186 G-protein coupled receptor signaling pathway GO:0007602 phototransduction GO:0008277 regulation of G-protein coupled receptor protein signaling pathway GO:0009968 negative regulation of signal transduction GO:0015031 protein transport GO:0016567 protein ubiquitination GO:0030168 platelet activation GO:0031397 negative regulation of protein ubiquitination
Organisms for which functions have been demonstratedHomo sapiens (human, a mammal)
Sequence length418 amino acids
FASTA sequence>sp|P49407|ARRB1_HUMAN Beta-arrestin-1 OS=Homo sapiens GN=ARRB1 PE=1 SV=2 MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR
Structure Information
PDB IDNot human, but bovine has 99% sequence identity
Quaternary structure
SCOPNA
CATHNA
TM Helix Predictionno TM helices
DisProt AnnotationNot in DisProt
Predicted Disorder RegionsPredicted disorder at N terminus (aa 1-9), middle region (aa 94-97, 174-191), and C terminus (aa 351-418)
Connections to Disease
OMIM ID
Function 1
Function descriptioncytosolic regulator and scaffold of GPCR signaling, interacts with activated receptors at cell membrane, resulting in receptor endocytosis and attenuation of receptor signalling
References for function
E.C. numberN/A
Location of functional site(s)
Cellular location of functioncytoplasm and cytoplasmic face of cell membrane
Comments
Function 2
Function descriptionregulation of histone acetylation and gene transcription, helps recruit histone acetyltransferase p300 to specific promoters, resulting in enhanced acetylation of histone H4 and transcription of those genes
References for functionKang J, Shi Y, Xiang B, Qu B, Su W, Zhu M, Zhang M, Bao G, Wang F, Zhang X, Yang R, Fan F, Chen X, Pei G, Ma L. A nuclear function of beta-arrestin1 in GPCR signaling: regulation of histone acetylation and gene transcription. Cell. 2005 Dec 2;123(5):833-47. PMID: 16325578.
E.C. number
Location of functional site(s)
Cellular location of functionnucleus
Comments