| General Information |
| MoonProt ID | 33 |
| First appeared in release | 1.0 |
| Name(s) | Enolase
2-phospho-D-glycerate hydro-lyase
2-phosphoglycerate dehydratase |
| UniProt ID | Q7YZX3 (Q7YZX3_ONCVO), Unreviewed |
| GO terms | GO:0006096 glycolysis
GO:0000287 magnesium ion binding
GO:0004634 phosphopyruvate hydratase activity
GO:0000015 phosphopyruvate hydratase complex |
| Organisms for which functions have been demonstrated | Onchocerca volvulus (cuases river blindness) |
| Sequence length | 435 |
| FASTA sequence | >gi|32440997|gb|AAP81756.1| enolase [Onchocerca volvulus]
MPITRVHARPIYDSRGNPTVEVDLTTEKGIFRAAVPSGASTGIHEALELRDNDEAVNHGKGVLQAVGNVNEQIGPALVAKNFCPTQQREIDLFMLQLDGTENKAKLGANAILGVSLAVCKAGAVHKGMPLYKYIAELAGTRQIVLPVPAMNVINGGSHAGNKLAMQEFMIMPVGASSFSEAMRMGSEIYHYLKAEIEKRYGLDATAVGDEGGFAPNIQDNKEGLDLLNTAIATAGYTGKVSIAMDCAASEYSKEADKLYDLKFKNPNSGKTQWKTGDQMMNFQSFIKEYPVVSIEDWFHEDDWHNWPKGLAKTNIQIVGDDLTVPNPKRIALAAEKKACNCLLLKVNQIGSVTESIDAANLARKNGWGVMVSHRSGETEDTFIADLVVGLAAGQIKTGAPCRSERLAKYNQILRIEEELGSAAVYAGQKFRNPQA |
| Structure Information |
| PDB ID | closest is human with 69% amino acid sequence identity |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-9), middle regions (aa 45-47), and C terminus (aa 429-435) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | Enolase, enzyme
2-phospho-D-glycerate => phosphoenolpyruvate + H2O
Catalyzes the reversible conversion of 2-phosphoglycerate into phosphoenolpyruvate
Carbohydrate degradation, glycolysis |
| References for function | |
| E.C. number | 4.2.1.11 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds plasminogen |
| References for function | Jolodar, A., Fischer, P., Bergmann, S., Buttner, D. W.,
Hammerschmidt, S. & Brattig, N. W. (2003). Molecular cloning of
an a-enolase from the human filarial parasite Onchocerca volvulus that
binds human plasminogen.Biochim Biophys Acta. 2003 Jun 19;1627(2-3):111-20.PMID: 12818429 |
| E.C. number | N/A |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |