| General Information |
| MoonProt ID | 349 |
| First appeared in release | 2.0 |
| Name(s) | glutathione S-transferase M3, GSTM, glutathione S-transferase Mu 3, GST class-mu 3, GSTM3-3, hGSTM3-3
Gene: GSTM3 |
| UniProt ID | P21266 (GSTM3_HUMAN) |
| GO terms | GO:0006749 glutathione metabolic process
GO:0008065 establishment of blood-nerve barrier
GO:0008152 metabolic process
GO:0018916 nitrobenzene metabolic process
GO:0042178 xenobiotic catabolic process
GO:0043627 response to estrogen
GO:0070458 cellular detoxification of nitrogen compound
GO:1901687 glutathione derivative biosynthetic process
GO:0004364 glutathione transferase activity
GO:0016740 transferase activity
GO:0019899 enzyme binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0043295 glutathione binding
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0035686 sperm fibrous sheath
GO:0070062 extracellular exosome |
| Organisms for which functions have been demonstrated | Homo sapiens (human, a mammal) |
| Sequence length | 225 amino acids |
| FASTA sequence | >sp|P21266|GSTM3_HUMAN Glutathione S-transferase Mu 3 OS=Homo sapiens GN=GSTM3 PE=1 SV=3
MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC |
| Structure Information |
| PDB ID | 3GTU |
| Quaternary structure | |
| SCOP | NA |
| CATH | 3.40.30.10 |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1-5, 222-225 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | glutathione S-transferase |
| References for function | |
| E.C. number | 2.5.1.18 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds to rhZP4, in head of sperm, interactions with zona pellucida proteins of egg |
| References for function | 9425104 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | sperm membrane |
| Comments | |