| General Information |
| MoonProt ID | 350 |
| First appeared in release | 2.0 |
| Name(s) | glutathione S-transferase, GST, GST Mu, Glutathione S-transferase Mu, Class mu glutathione S-transferase |
| UniProt ID | Q9MZB4 (Q9MZB4_CAPHI) |
| GO terms | GO:0008152 metabolic process
GO:0004364 glutathione transferase activity
GO:0016740 transferase activity |
| Organisms for which functions have been demonstrated | Capra hircus (goat, a mammal) |
| Sequence length | 188 amino acids |
| FASTA sequence | >tr|Q9MZB4|Q9MZB4_CAPHI Class mu glutathione S-transferase (Fragment) OS=Capra hircus PE=2 SV=1
RLLLEYTDSNYEEKKYTMGDAPDYDRSQWLNEKSKLGLDFPNLPYLIDGTHKLTQSNAILRHIARKYNMCGETEEEKIRVDLLENQVMDVRLHMARICYSPDFEKLKPGYLKEIPGRMKLFSVFLGKRCWFAGNKLTYVDFLAYDILDLQRIFEPRCLDEFRNLKDFLTRFEGLKKISGYMKSSRFLP |
| Structure Information |
| PDB ID | |
| Quaternary structure | |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 185-188 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | glutathione S-transferase, detoxify electrophilic compounds |
| References for function | 11973347 |
| E.C. number | 2.5.1.18 |
| Location of functional site(s) | |
| Cellular location of function | catalytically active on sperm plasma membrane |
| Comments | |
| Function 2 |
| Function description | binds ZP3 protein component of zona pellucida, serves as a gamete recognition molecule, binds specifically to zona pellucida (of egg) during the first phase of sperm–oocyte interactions |
| References for function | 11973347 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | surface of sperm plasma membrane, attached by non-covalent methods |
| Comments | anti-GST antibodies prevent fertilization but not GST catalytic activity |