| General Information |
| MoonProt ID | 352 |
| First appeared in release | 2.0 |
| Name(s) | glycerol 3-phosphate dehydrogenase, Gpd2, Glycerol-3-phosphate dehydrogenase [NAD(+)] 2, mitochondrial
Gene: GPD2 |
| UniProt ID | P41911 (GPD2_YEAST) |
| GO terms | GO:0005975 carbohydrate metabolic process
GO:0006071 glycerol metabolic process
GO:0006072 glycerol-3-phosphate metabolic process
GO:0006116 NADH oxidation
GO:0046168 glycerol-3-phosphate catabolic process
GO:0055114 oxidation-reduction process
GO:0004367 glycerol-3-phosphate dehydrogenase [NAD+] activity
GO:0005515 protein binding
GO:0016491 oxidoreductase activity
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0042803 protein homodimerization activity
GO:0051287 NAD binding
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0009331 glycerol-3-phosphate dehydrogenase complex |
| Organisms for which functions have been demonstrated | Candida albicans (yeast, a fungi, can cause candiadiasis) |
| Sequence length | 371 amino acids |
| FASTA sequence | >sp|P41911|GPD2_YEAST Glycerol-3-phosphate dehydrogenase [NAD(+)] 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPD2 PE=1 SV=2
MLAVRRLTRYTFLKRTHPVLYTRRAYKILPSRSTFLRRSLLQTQLHSKMTAHTNIKQHKHCHEDHPIRRSDSAVSIVHLKRAPFKVTVIGSGNWGTTIAKVIAENTELHSHIFEPEVRMWVFDEKIGDENLTDIINTRHQNVKYLPNIDLPHNLVADPDLLHSIKGADILVFNIPHQFLPNIVKQLQGHVAPHVRAISCLKGFELGSKGVQLLSSYVTDELGIQCGALSGANLAPEVAKEHWSETTVAYQLPKDYQGDGKDVDHKILKLLFHRPYFHVNVIDDVAGISIAGALKNVVALACGFVEGMGWGNNASAAIQRLGLGEIIKFGRMFFPESKVETYYQESAGVADLITTCSGGRNVKVATYMAKTGKSALEAEKELLNGQSAQGIITCREVHEWLQTCELTQEFPLFEAVYQIVYNNVRMEDLPEMIEELDIDDE |
| Structure Information |
| PDB ID | |
| Quaternary structure | |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1-11, 42-76, 433-440 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | glycerol 3-phosphate dehydrogenase, functions in glycerol accumulation |
| References for function | 7476212 |
| E.C. number | 1.1.1.8 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | NAD dependent enzyme |
| Function 2 |
| Function description | plasminogen binding |
| References for function | Luo S, Hoffmann R, Skerka C, Zipfel PF. 2013. Glycerol-3-phosphate dehydrogenase 2 is a novel factor H-, factor H-like protein 1-, and plasminogenbinding surface protein of Candida albicans. J Infect Dis 207:594-603. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | lysine analogue aminocaproic acid (?ACA) inhibits Gpd2-plasminogen
interaction |