| General Information |
| MoonProt ID | 372 |
| First appeared in release | 2.0 |
| Name(s) | peroxiredoxin 5, Gene: PRDX5 |
| UniProt ID | Q9GLW8 (Q9GLW8_PIG) |
| GO terms | GO:0055114 oxidation-reduction process
GO:0016491 oxidoreductase activity |
| Organisms for which functions have been demonstrated | Sus scrofa (pig) |
| Sequence length | 162 amino acids |
| FASTA sequence | >tr|Q9GLW8|Q9GLW8_PIG Peroxiredoxin 5 OS=Sus scrofa GN=PRDX5 PE=2 SV=1
MAPIKVGDAIPSVVVFEGEPEKKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGIQVVACLSVNDVFVTEMWGRAHNTEGKVRLLADPTGAFGKETDLLLDDSLVSLFGNRRLKRFSMVIEDGIVKSLNVEPDDTGLTCSLAPNIISQL |
| Structure Information |
| PDB ID | |
| Quaternary structure | |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | peroxiredoxin |
| References for function | |
| E.C. number | 1.11.1.15 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | sperm plasma membrane protein interacting with zona pellucida proteins |
| References for function | 17483085 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | sperm plasma membrane |
| Comments | |