| General Information |
| MoonProt ID | 373 |
| First appeared in release | 2.0 |
| Name(s) | alkyl hydroperoxide reductase AhpC, peroxiredoxin, 2-Cys Peroxiredoxin Alkyl Hydroperoxide Reductase C, Gene: ahpC |
| UniProt ID | E7S2A7 (E7S2A7_STRA8) |
| GO terms | GO:0006979 response to oxidative stress
GO:0055114 oxidation-reduction process
GO:0098869 cellular oxidant detoxification
GO:0004601 peroxidase activity
GO:0016209 antioxidant activity
GO:0016491 oxidoreductase activity
GO:0051920 peroxiredoxin activity |
| Organisms for which functions have been demonstrated | Streptococcus agalactiae, group B Streptococcus (Gram positive bacterium) |
| Sequence length | 186 amino acids |
| FASTA sequence | >tr|E7S2A7|E7S2A7_STRA8 Peroxiredoxin OS=Streptococcus agalactiae (strain ATCC 13813 / DSM 2134 / JCM 5671 / NCIMB 701348 / NCTC 8181) GN=ahpC PE=4 SV=1
MSLVGKEIIEFSAQAYHDGKFITVTNEDVKGKWAVFCFYPADFSFVCPTELGDLQEQYETLKSLDVEVYSVSTDTHFVHKAWHDDSDVVGTITYPMIGDPSHLISQGFDVLGQDGLAQRGTFIIDPDGVIQMMEINADGIGRDASTLIDKVRAAQYIRQHPGEVCPAKWKEGAETLTPSLDLVGKI |
| Structure Information |
| PDB ID | none, but structures of some homologues |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1-2, 186 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | peroxiredoxin, hydroxyperoxidase activity |
| References for function | 20332091 |
| E.C. number | 1.11.1.15 |
| Location of functional site(s) | |
| Cellular location of function | |
| Comments | does not require heme for hydroperoxidase activity |
| Function 2 |
| Function description | heme binding protein |
| References for function | 20332091 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | |
| Comments | |