| General Information |
| MoonProt ID | 377 |
| First appeared in release | 2.0 |
| Name(s) | phospholipid hydroperoxide glutathione peroxidase (mitochondrial), glutathione peroxidase 4, GPx-4, GSHPx-4, PHGPx, Gene: GPX4 |
| UniProt ID | P36969 (GPX4_HUMAN) |
| GO terms | GO:0006644 phospholipid metabolic process
GO:0006979 response to oxidative stress
GO:0007275 multicellular organism development
GO:0019372 lipoxygenase pathway
GO:0055114 oxidation-reduction process
GO:0098869 cellular oxidant detoxification
GO:0004601 peroxidase activity
GO:0004602 glutathione peroxidase activity
GO:0016491 oxidoreductase activity
GO:0047066 phospholipid-hydroperoxide glutathione peroxidase activity
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0070062 extracellular exosome |
| Organisms for which functions have been demonstrated | Homo sapiens (human, a mammal) |
| Sequence length | 197 amino acids |
| FASTA sequence | >sp|P36969|GPX4_HUMAN Phospholipid hydroperoxide glutathione peroxidase, mitochondrial OS=Homo sapiens GN=GPX4 PE=1 SV=3
MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF |
| Structure Information |
| PDB ID | 2OBI, 2GS3 |
| Quaternary structure | |
| SCOP | Thioredoxin fold |
| CATH | 3.40.30.10 |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-2), and C terminus (aa 193-197) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | phospholipid hydroperoxide glutathione peroxidase, 2 glutathione + a hydroperoxy-fatty-acyl-[lipid] -> glutathione disulfide + a hydroxy-fatty-acyl-[lipid] |
| References for function | |
| E.C. number | 1.11.1.12 |
| Location of functional site(s) | |
| Cellular location of function | mitochondria |
| Comments | |
| Function 2 |
| Function description | interactions with zona pellucida proteins of egg |
| References for function | 23355646 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | head of sperm, sperm membrane |
| Comments | |