| General Information |
| MoonProt ID | 390 |
| First appeared in release | 2.0 |
| Name(s) | succinate dehydrogenase subunit 3, sdh3, Succinate dehydrogenase [ubiquinone] cytochrome b subunit, mitochondrial, CYB3
Gene: SDH3 |
| UniProt ID | P33421 (SDH3_YEAST) |
| GO terms | GO:0006099 tricarboxylic acid cycle
GO:0006121 mitochondrial electron transport, succinate to ubiquinone
GO:0045039 protein import into mitochondrial inner membrane
GO:0045333 cellular respiration
GO:0055114 oxidation-reduction process
GO:0000104 succinate dehydrogenase activity
GO:0009055 electron carrier activity
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors
GO:0046872 metal ion binding
GO:0048038 quinone binding
GO:0008177 succinate dehydrogenase (ubiquinone) activity
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005749 mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone)
GO:0016020 membrane
GO:0016021 integral component of membrane
GO:0042721 mitochondrial inner membrane protein insertion complex |
| Organisms for which functions have been demonstrated | Saccharomyces cerevisiae (yeast, fungi) |
| Sequence length | 198 amino acids |
| FASTA sequence | >sp|P33421|SDH3_YEAST Succinate dehydrogenase [ubiquinone] cytochrome b subunit, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDH3 PE=1 SV=1
MSAMMVKLGLNKSALLLKPSAFSRAAALSSSRRLLFNTARTNFLSTSPLKNVASEMNTKAAIAEEQILNKQRAKRPISPHLTIYQPQLTWYLSSLHRISLVLMGLGFYLFTILFGVSGLLGLGLTTEKVSNWYHQKFSKITEWSIKGSFAYLFAIHYGGAIRHLIWDTAKELTLKGVYRTGYALIGFTAVLGTYLLTL |
| Structure Information |
| PDB ID | |
| Quaternary structure | |
| SCOP | |
| CATH | |
| TM Helix Prediction | 3(100-122,143-165,180-197) |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1-13, 47-63, 198 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | subunit of succinate dehydrogenase in the respiratory chain, electron transport in respiratory complex II |
| References for function | 15989954, 11803020, 12560550 |
| E.C. number | 1.3.5.1 |
| Location of functional site(s) | |
| Cellular location of function | transmembrane protein in mitochondrial inner membrane |
| Comments | |
| Function 2 |
| Function description | part of TIM22 complex (carrier translocase, mitochondrial inner membrane translocase) in mitochondria, helps in biogenesis and assembly of membrane-integral subunits of TIM22 complex |
| References for function | 22152483 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | transmembrane protein in mitochondrial inner membrane |
| Comments | |