| General Information |
| MoonProt ID | 397 |
| First appeared in release | 2.0 |
| Name(s) | VPS22, Larsen, GH19864p, Gene: lsn |
| UniProt ID | Q9VD72 (Q9VD72_DROME) |
| GO terms | GO:0007567 parturition
GO:0008105 asymmetric protein localization
GO:0008283 cell proliferation
GO:0008593 regulation of Notch signaling pathway
GO:0019233 sensory perception of pain
GO:0032509 endosome transport via multivesicular body sorting pathway
GO:0036258 multivesicular body assembly
GO:0042059 negative regulation of epidermal growth factor receptor signaling pathway
GO:0042981 regulation of apoptotic process
GO:0043162 ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0043328 protein targeting to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0045450 bicoid mRNA localization
GO:0003674 molecular_function
GO:0000814 ESCRT II complex |
| Organisms for which functions have been demonstrated | Drosophila melanogaster (fruit fly, an insect) |
| Sequence length | 254 amino acids |
| FASTA sequence | >tr|Q9VD72|Q9VD72_DROME GH19864p OS=Drosophila melanogaster GN=lsn PE=1 SV=1
MRRRVGLGAIQQQKLAAEKYKDKGTDLQENQLEQMTKQMEVFRVKLEEFAMKHKEDIRKNSQFRKQFQEMCAAIGVDPLATGKGFWSVLGMGDFYYELGVQVVEVCLAANHKTGGLMELDDLRRRLIAARGQSSVHQEITKEDILMAAKKLSIFGNGFVVHKLGKGKYIVQSIPGELSMEETNILNAASNTEQGCVTQSQLIKDLGWTDYRAQQSLDKVLGEGLCWIDKQAGDEPAYWFPSLFPGRNAQTTAAT |
| Structure Information |
| PDB ID | none, but structures available of homologues |
| Quaternary structure | |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | 1-3, 6, 9-14, 133-135, 248-254 |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | component of ESCRT-II (endosomal sorting complex required for transport), functions in exosomal sorting pathway that sorts ubiquitinated endosomal proteins into internal vesicles |
| References for function | |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | |
| Comments | |
| Function 2 |
| Function description | bind bicoid mRNA to cause localization to anterior of egg |
| References for function | Irion U, St Johnston D. (2007) bicoid RNA localization requires specific binding of an endosomal sorting complex. Nature 445, 554–558. PMID: 17268469. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | egg |
| Comments | |