| General Information |
| MoonProt ID | 3978 |
| First appeared in release | 4.0 |
| Name(s) | Streptococcus sobrinus |
| UniProt ID | Q845Q5 |
| GO terms | GO:0000287 magnesium ion binding, GO:0004634 phosphopyruvate hydratase activity, GO:0016829 lyase activity, GO:0046872 metal ion binding, GO:0006096 glycolytic process, GO:0005576 extracellular region, GO:0005737 cytoplasm, GO:0009274 peptidoglycan-based cell wall, GO:0009986 cell surface, GO:0000015 phosphopyruvate hydratase complex |
| Organisms for which functions have been demonstrated | Streptococcus sobrinus |
| Sequence length | 433.0 |
| FASTA sequence | ">tr|Q845Q5|Q845Q5_9STRE Enolase OS=Streptococcus sobrinus OX=1310 GN=eno1 PE=3 SV=1
MSIITDVYAREVLDSRGNPTLEVEVYTESGAFGRGMVPSGASTGEHEAVELRDGDKSRYG
GLGTQKAVDNVNNIIAEAIIGYDVRDQQAIDRAMIALDGTPNKGKLGANAILGVSIAAAR
AAADYLEIPLYSYLGGFNTKVLPTPMMNIVNGGSHSDAPIAFQEFMIMPVGAPTFKEGLR
WGAEVFHALKKILKERGLETAVGDEGGFAPRFDGIEDGVETILKAIETAGYEAGEKGIML
GFDCASSEFYEDGVYDYTKFEGEKGAKRSAAEQIDYIEGLVNKYPIITIEDAMDENDWEG
WKALTERLGNRVQLVGDDFFVTNTDYLARGIKEGAANSILIKVNQIGTLTETFEAIEMAK
EAGYTAVVSHRSGETEDSTIADIAVATNAGQIKTGSLSRTDRMAKYNQLLRIEDQLGEVA
QYKGINSFYNLKK" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, enolase, 2-phospho-D-glycerate => phosphoenolpyruvate + H2O Catalyzes the reversible conversion of 2-phosphoglycerate into phosphoenolpyruvate. Carbohydrate degradation, glycolysis |
| References for function | Veiga-Malta, I., Duarte, M., Dinis, M., Tavares, D., Videira, A., & Ferreira, P. (2004). Enolase from Streptococcus sobrinus is an immunosuppressive protein. Cellular microbiology, 6(1), 79–88. https://doi.org/10.1046/j.1462-5822.2003.00344.x |
| E.C. number | EC:4.2.1.11 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | secreted protein that suppresses host immune response |
| References for function | Veiga-Malta, I., Duarte, M., Dinis, M., Tavares, D., Videira, A., & Ferreira, P. (2004). Enolase from Streptococcus sobrinus is an immunosuppressive protein. Cellular microbiology, 6(1), 79–88. https://doi.org/10.1046/j.1462-5822.2003.00344.x |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | secreted |
| Comments | |