| General Information |
| MoonProt ID | 398 |
| First appeared in release | 4.0 |
| Name(s) | glucose 6-phosphate dehydrogenase |
| UniProt ID | Q00612 |
| GO terms | GO:0001998 angiotensin-mediated vasoconstriction involved in regulation of systemic arterial blood pressure
GO:0002033 angiotensin-mediated vasodilation involved in regulation of systemic arterial blood pressure
GO:0006741 NADP+ biosynthetic process
GO:0006749 glutathione metabolic process
GO:0006979 response to oxidative stress
GO:0019322 pentose biosynthetic process
GO:0040014 regulation of multicellular organism growth
GO:0048821 erythrocyte development
GO:0004345 glucose-6-phosphate dehydrogenase activity
GO:0005536 D-glucose binding
GO:0016491 oxidoreductase activity
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors
GO:0030246 carbohydrate binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0050661 NADP binding
GO:0006006 glucose metabolic process
GO:0006098 pentose-phosphate shunt
GO:0006695 cholesterol biosynthetic process
GO:0006739 NADP+ metabolic process
GO:0006740 NADPH regeneration
GO:0006749 glutathione metabolic process
GO:0009051 pentose-phosphate shunt, oxidative branch
GO:0019322 pentose biosynthetic process
GO:0034599 cellular response to oxidative stress
GO:0043249 erythrocyte maturation
GO:0043523 regulation of neuron apoptotic process
GO:0045471 response to ethanol
GO:0046390 ribose phosphate biosynthetic process
GO:0051156 glucose 6-phosphate metabolic process
GO:0061052 negative regulation of cell growth involved in cardiac muscle cell development
GO:1904879 positive regulation of calcium ion transmembrane transport via high voltage-gated calcium channel
GO:2000378 negative regulation of reactive oxygen species metabolic process
GO:0005829 cytosol
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0009898 cytoplasmic side of plasma membrane
GO:0016020 membrane
GO:0034451 centriolar satellite |
| Organisms for which functions have been demonstrated | Mus musculus |
| Sequence length | 515 |
| FASTA sequence | >sp|Q00612|G6PD1_MOUSE Glucose-6-phosphate 1-dehydrogenase X OS=Mus musculus OX=10090 GN=G6pdx PE=1 SV=3
MAEQVALSRTQVCGILREELYQGDAFHQADTHIFIIMGASGDLAKKKIYPTIWWLFRDGL
LPEDTFIVGYARSRLTVDDIRKQSEPFFKATPEERPKLEEFFARNSYVAGQYDDAASYKH
LNSHMNALHQGMQANRLFYLALPPTVYEAVTKNIQETCMSQTGWNRIIVEKPFGRDLQSS
NQLSNHISSLFREDQIYRIDHYLGKEMVQNLMVLRFANRIFGPIWNRDNIACVILTFKEP
FGTEGRGGYFDEFGIIRDVMQNHLLQMLCLVAMEKPATTGSDDVRDEKVKVLKCISEVET
DNVVLGQYVGNPNGEGEAANGYLDDPTVPHGSTTATFAAAVLYVENERWDGVPFILRCGK
ALNERKAEVRLQFRDVAGDIFHQQCKRNELVIRVQPNEAVYTKMMTKKPGMFFNPEESEL
DLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHKIDREKPQPI
PYVYGSRGPTEADELMKRVGFQYEGTYKWVNPHKL |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, glucose 6-phosphate dehydrogenase |
| References for function | McGowan K, Pekala PH. Dehydrogenase binding to the 3'-untranslated region of GLUT1 mRNA. Biochem Biophys Res Commun. 1996 Apr 5;221(1):42-5. doi: 10.1006/bbrc.1996.0541. PMID: 8660340 |
| E.C. number | 1.1.1.49 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds RNA, binds to 3'UTR of GLUT1 mRNA |
| References for function | McGowan K, Pekala PH. Dehydrogenase binding to the 3'-untranslated region of GLUT1 mRNA. Biochem Biophys Res Commun. 1996 Apr 5;221(1):42-5. doi: 10.1006/bbrc.1996.0541. PMID: 8660340 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |