| General Information |
| MoonProt ID | 3981 |
| First appeared in release | 4.0 |
| Name(s) | Taenia pisiformis (Rabbit Tapeworm) (Cysticercus pisiformis) |
| UniProt ID | T1WGD6 |
| GO terms | GO:0000287 magnesium ion binding, GO:0004634 phosphopyruvate hydratase activity, GO:0016829 lyase activity, GO:0046872 metal ion binding, GO:0006096 glycolytic process, GO:0000015 phosphopyruvate hydratase complex |
| Organisms for which functions have been demonstrated | Taenia pisiformis (Rabbit Tapeworm) (Cysticercus pisiformis) |
| Sequence length | 433.0 |
| FASTA sequence | ">tr|T1WGD6|T1WGD6_TAEPI Enolase OS=Taenia pisiformis OX=85432 PE=2 SV=1
MSIQNIHARQIFDSRGNPTVEVDLTTSKGMFRAAVPSGASTGIHEAVELRDGDKNAYMGK
GVLHAVKNVNEIIAPALLKEKFIVTDQEKIDEFMIKLDGSPNKGKLGANAILGVSLAVCK
AGAAEKCVPLYRHIADLANNKDVVLPVPAFNVLNGGSHAGNKLAMQEFMILPTGAKNFTE
AMKMGTEVYHHLKSVIKGKYGLDACNVGDEGGFAPNIQDNMEGLELLKTAIDKAGYTGKV
KIGMDVAASEFYQNGKYNLDFKNPKAAASSIVPGSKLAEIYLEMLSKYPIVSIEDPFDQD
DWPAWTDFNAKAGIQIVGDDLTVTNPERVQLAIDKKACNALLLKVNQIGSVTESIRACRM
SRAAGWGVMVSHRSGETEDSTIADIVVGLRTGQIKTGAPCRSERLAKYNQLLRIEEELGS
KAVYAGEHFRNPL" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, enolase, 2-phospho-D-glycerate => phosphoenolpyruvate + H2O Catalyzes the reversible conversion of 2-phosphoglycerate into phosphoenolpyruvate. Carbohydrate degradation, glycolysis |
| References for function | Zhang S, Guo A, Zhu X, You Y, Hou J, Wang Q, Luo X, Cai X. Identification and functional characterization of alpha-enolase from Taenia pisiformis metacestode. Acta Trop. 2015 Apr;144:31-40. doi: 10.1016/j.actatropica.2015.01.007. Epub 2015 Jan 23. PMID: 25623259. |
| E.C. number | EC:4.2.1.11 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds to plasminogen and aids its activation to plasmin in the presence of tissue plasminogen activator (tPA) |
| References for function | Zhang S, Guo A, Zhu X, You Y, Hou J, Wang Q, Luo X, Cai X. Identification and functional characterization of alpha-enolase from Taenia pisiformis metacestode. Acta Trop. 2015 Apr;144:31-40. doi: 10.1016/j.actatropica.2015.01.007. Epub 2015 Jan 23. PMID: 25623259. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |