| General Information |
| MoonProt ID | 3982 |
| First appeared in release | 4.0 |
| Name(s) | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) |
| UniProt ID | Q9P940 |
| GO terms | GO:0009986 cell surface ; GO:0005737 cytoplasm, GO:0005829 cytosol ; GO:0009277 fungal-type cell wall ; GO:0062040 fungal biofilm matrix ; GO:0030446 hyphal cell wall ; GO:0004807 triose-phosphate isomerase activity ; GO:0061621 canonical glycolysis ; GO:0009267 cellular response to starvation ; GO:0030447 filamentous growth ; GO:0036180 filamentous growth of a population of unicellular organisms in response to biotic stimulus ; GO:0036170 filamentous growth of a population of unicellular organisms in response to starvation ; GO:0006094 gluconeogenesis ; GO:0046166 glyceraldehyde-3-phosphate biosynthetic process ; GO:0019563 glycerol catabolic process ; GO:0006096 glycolytic process ; GO:0052553 symbiont-mediated perturbation of host immune response. |
| Organisms for which functions have been demonstrated | Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) |
| Sequence length | 248.0 |
| FASTA sequence | ">sp|Q9P940|TPIS_CANAL Triosephosphate isomerase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TPI1 PE=1 SV=3
MARQFFVGGNFKANGTKQQITSIIDNLNKADLPKDVEVVICPPALYLGLAVEQNKQPTVA
IGAQNVFDKSCGAFTGETCASQILDVGASWTLTGHSERRTIIKESDEFIAEKTKFALDTG
VKVILCIGETLEERKGGVTLDVCARQLDAVSKIVSDWSNIVVAYEPVWAIGTGLAATPED
AEETHKGIRAHLAKSIGAEQAEKTRILYGGSVNGKNAKDFKDKANVDGFLVGGASLKPEF
VDIIKSRL" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, converts dihydroxyaceone phosphate DHAP to Glyceraldehyde-3-phosphate GAP, in glycolysis and gluconeogenesis |
| References for function | Satala, D., Satala, G., Zawrotniak, M., & Kozik, A. (2021). Candida albicans and Candida glabrata triosephosphate isomerase – a moonlighting protein that can be exposed on the candidal cell surface and bind to human extracellular matrix proteins. BMC Microbiology, 21, 199. https://doi.org/10.1186/s12866-021-02235-w |
| E.C. number | 5.3.1.1 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | Adhesion mediator on the fungal cell surface |
| References for function | Satala, D., Satala, G., Zawrotniak, M., & Kozik, A. (2021). Candida albicans and Candida glabrata triosephosphate isomerase – a moonlighting protein that can be exposed on the candidal cell surface and bind to human extracellular matrix proteins. BMC Microbiology, 21, 199. https://doi.org/10.1186/s12866-021-02235-w |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |