| General Information |
| MoonProt ID | 3983 |
| First appeared in release | 4.0 |
| Name(s) | Trichomonas vaginalis (strain ATCC PRA-98 / G3) |
| UniProt ID | A2EGX9 |
| GO terms | "GO:0004807 triose-phosphate isomerase activity GO:0004807 triose-phosphate isomerase activity GO:0016853 isomerase activity GO:0006094 gluconeogenesis GO:0006094 gluconeogenesis GO:0006096 glycolytic process GO:0006096 glycolytic process GO:0006096 glycolytic process GO:0019563 glycerol catabolic process GO:0046166 glyceraldehyde-3-phosphate biosynthetic process GO:0005829 cytosol" |
| Organisms for which functions have been demonstrated | Trichomonas vaginalis (strain ATCC PRA-98 / G3) |
| Sequence length | 252.0 |
| FASTA sequence | ">tr|A2FT29|A2FT29_TRIV3 Triosephosphate isomerase OS=Trichomonas vaginalis (strain ATCC PRA-98 / G3) OX=412133 GN=TVAG_096350 PE=1 SV=1
MRTFFVGGNWKANPKTVQEAEKLVEMLNGAKVEGNVEVVVAAPFVFLPTLQQKLRKDWKV
SAENVFTKPNGAFTGEVTVPMIKSFGIEWTILGHSERRDILKEDDEFLAAKAKFALENGM
KIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQ
DAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAACPDVDGFLVGGASLEAG
FINIVNSNVHSK" |
| Structure Information |
| PDB ID | 3QST 4WJE 5VWN |
| Quaternary structure | NA |
| SCOP | "80616634WJE A
80616644WJE A" |
| CATH | 3.20.20.70 |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, triose phosphate isomerase |
| References for function | Miranda-Ozuna JF, Hernández-García MS, Brieba LG, Benítez-Cardoza CG, Ortega-López J, González-Robles A, Arroyo R. The Glycolytic Enzyme Triosephosphate Isomerase of Trichomonas vaginalis Is a Surface-Associated Protein Induced by Glucose That Functions as a Laminin- and Fibronectin-Binding Protein. Infect Immun. 2016 Sep 19;84(10):2878-94. doi: 10.1128/IAI.00538-16. PMID: 27481251; PMCID: PMC5038057. |
| E.C. number | EC:5.3.1.1 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | adhesin, binds laminin and fibronectin |
| References for function | Miranda-Ozuna JF, Hernández-García MS, Brieba LG, Benítez-Cardoza CG, Ortega-López J, González-Robles A, Arroyo R. The Glycolytic Enzyme Triosephosphate Isomerase of Trichomonas vaginalis Is a Surface-Associated Protein Induced by Glucose That Functions as a Laminin- and Fibronectin-Binding Protein. Infect Immun. 2016 Sep 19;84(10):2878-94. doi: 10.1128/IAI.00538-16. PMID: 27481251; PMCID: PMC5038057. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |