| General Information |
| MoonProt ID | 3991 |
| First appeared in release | 4.0 |
| Name(s) | Mycoplasma pneumoniae |
| UniProt ID | P75392 |
| GO terms | GO:0004742 dihydrolipoyllysine-residue acetyltransferase activity, GO:0005515 protein binding, GO:0016407 acetyltransferase activity, GO:0016740 transferase activity, GO:0016746 acyltransferase activity, GO:0031405 lipoic acid binding, GO:0005737 cytoplasm, GO:0005829 cytosol, GO:0009986 cell surface, GO:0016020 membrane |
| Organisms for which functions have been demonstrated | Mycoplasma pneumoniae |
| Sequence length | 402.0 |
| FASTA sequence | ">sp|P75392|ODP2_MYCPN Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) OX=272634 GN=pdhC PE=1 SV=1
MANEFKFTDVGEGLHEGKVTEILKKVGDTIKVDEALFVVETDKVTTELPSPYAGVITAIT
TNVGDVVHIGQVMAVIDDGAGAAAPAAPQPVSAPAPAPTPTFTPTPAPVTTEPVVEEAGA
SVVGEIKVSNSVFPIFGVQPSAPQPTPAPVVQPTSAPTPTPAPASAAAPSGEETIAITTM
RKAIAEAMVKSHENIPATILTFYVNATKLKQYRESVNGLALSKYNMKISFFAFFVKAIVN
ALKKFPVFNGRYDKERNLIVLNKDVNVGIAVDTPDGLIVPNIKQAQTKSVVDIAKDIVDL
ANRARSKQIKLPDLSKGTISVTNFGSLGAAFGTPIIKHPEMCIVATGNMEERVVRAEGGV
AVHTILPLTIAADHRWVDGADVGRFGKEIAKQIEELIDLEVA" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | multiprotein complex |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, pyruvate dehydrogenase C |
| References for function | _ |
| E.C. number | EC:2.3.1.12 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | adhesin, binds host ECM, binds lactoferrin, laminin, vitronecting, fibrinogen, fibronectin |
| References for function | Gründel A, Jacobs E, Dumke R. Interactions of surface-displayed glycolytic enzymes of Mycoplasma pneumoniae with components of the human extracellular matrix. Int J Med Microbiol. 2016 Dec;306(8):675-685. doi: 10.1016/j.ijmm.2016.09.001. Epub 2016 Sep 3. PMID: 27616280. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |