| General Information |
| MoonProt ID | 3995 |
| First appeared in release | 4.0 |
| Name(s) | Dirofilaria immitis (Canine heartworm) |
| UniProt ID | I3WTW5 |
| GO terms | "GO:0000166 nucleotide binding
GO:0004365 glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity
GO:0016491 oxidoreductase activity
GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0050661 NADP binding
GO:0006006 glucose metabolic process
GO:0006096 glycolytic process
GO:0019682 glyceraldehyde-3-phosphate metabolic process
GO:0005829 cytosol" |
| Organisms for which functions have been demonstrated | Dirofilaria immitis (Canine heartworm) |
| Sequence length | 339.0 |
| FASTA sequence | ">tr|I3WTW5|I3WTW5_DIRIM Glyceraldehyde-3-phosphate dehydrogenase OS=Dirofilaria immitis OX=6287 PE=2 SV=1
MSKPKIGINGFGRIGRLVLRAAVEKNTVDVVAVNDPFINIDYMVYMFKYDSTHGRFKGNV
SAEGGKLVVTNGQTTHHISVHNSKDPAEIPWGVDGAEYVVESTGVFTTTEKASAHLKGGA
KKVIISAPSADAPMFVMGVNNETYDKANNHIISNASCTTNCLAPLAKVIHDKFGIIEGLM
TTVHATTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPDLNGKLTGMAFRV
PTPDVSVVDLTCRLQKGATMDEIKAAVKEAAAGPMKGILEYTEDQVVSSDFIGDAHSSIF
DALACISLNPNFVKLIAWYDNEYGYSNRVVDLISYIASR" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, glyceraldehyde 3-phosphate dehydrogenase, catalyzes the reversible oxidative phosphorylation of glyceraldehyde 3-phosphate to 1,3-bisphosphate coupled with reduction of NAD+ to NADH |
| References for function | González-Miguel J, Morchón R, Siles-Lucas M, Oleaga A, Simón F. Surface-displayed glyceraldehyde 3-phosphate dehydrogenase and galectin from Dirofilaria immitis enhance the activation of the fibrinolytic system of the host. Acta Trop. 2015 May;145:8-16. doi: 10.1016/j.actatropica.2015.01.010. Epub 2015 Feb 7. PMID: 25666684. |
| E.C. number | EC:1.2.1.12 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | bind plasminogen and stimulate plasmin generation by tissue plasminogen activator |
| References for function | Gonzalez-MiguGonzález-Miguel J, Morchón R, Siles-Lucas M, Oleaga A, Simón F. Surface-displayed glyceraldehyde 3-phosphate dehydrogenase and galectin from Dirofilaria immitis enhance the activation of the fibrinolytic system of the host. Acta Trop. 2015 May;145:8-16. doi: 10.1016/j.actatropica.2015.01.010. Epub 2015 Feb 7. PMID: 25666684.el et al., 2015 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |