| General Information |
| MoonProt ID | 3996 |
| First appeared in release | 4.0 |
| Name(s) | Dirofilaria immitis (Canine heartworm) |
| UniProt ID | I3WTW4 |
| GO terms | "GO:0004332 fructose-bisphosphate aldolase activity
GO:0016829 lyase activity
GO:0006096 glycolytic process" |
| Organisms for which functions have been demonstrated | Dirofilaria immitis (Canine heartworm) |
| Sequence length | 363.0 |
| FASTA sequence | ">tr|I3WTW4|I3WTW4_DIRIM Fructose-bisphosphate aldolase OS=Dirofilaria immitis OX=6287 PE=2 SV=1
MTSYSQFLTEAQKDELRQIANQIVAPGKGILAADESVGSMDKKLKPIGLENVEENRRLYR
QLLFTAGDEMSKYISGVIMFHESFYHKADDGTPFVQILQKKGILPGIKVDKGVVPMAGTV
GEGTTQGLDDLNSRCAQYKKGGAQFAKWRCVHKIGATTPSHMALVEIAEVLARYASICQQ
HGLVPIVEPETLPDGEHDVHRCQKVTELVLSYTYKALIDHHVYLEGTLLKPNMCMPGMQF
KGQCSHEEIARATVTALRRTVPVAVPGIVFLSGGQSEEDATLNLNAINQFSGKKPWALTF
SYGRALQASALAAWGGKPENIQAAKEAFLKRAEANSLAQLGKYTGGAGSGAAGENLYIAN
HAY" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, GTP hydrolase that promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis. |
| References for function | Gonzalez-MiguGonzález-Miguel J, Morchón R, Siles-Lucas M, Oleaga A, Simón F. Surface-displayed glyceraldehyde 3-phosphate dehydrogenase and galectin from Dirofilaria immitis enhance the activation of the fibrinolytic system of the host. Acta Trop. 2015 May;145:8-16. doi: 10.1016/j.actatropica.2015.01.010. Epub 2015 Feb 7. PMID: 25666684.el et al., 2015 |
| E.C. number | EC:4.1.2.13 |
| Location of functional site(s) | |
| Cellular location of function | Cytoplasm |
| Comments | |
| Function 2 |
| Function description | Cytoplasm |
| References for function | Gonzalez-MiguGonzález-Miguel J, Morchón R, Siles-Lucas M, Oleaga A, Simón F. Surface-displayed glyceraldehyde 3-phosphate dehydrogenase and galectin from Dirofilaria immitis enhance the activation of the fibrinolytic system of the host. Acta Trop. 2015 May;145:8-16. doi: 10.1016/j.actatropica.2015.01.010. Epub 2015 Feb 7. PMID: 25666684.el et al., 2015 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |