| General Information |
| MoonProt ID | 400 |
| First appeared in release | 3.0 |
| Name(s) | ADP/ATP translocase 2 or Adenine nucleotide translocator 2 |
| UniProt ID | P05141 (ADT2_HUMAN) |
| GO terms | GO:0005887 integral component of plasma membrane
GO:0005743 mitochondrial inner membrane
GO:0005743 mitochondrial inner membrane
GO:0050796 regulation of insulin secretion
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005743 mitochondrial inner membrane
GO:1990830 cellular response to leukemia inhibitory factor
GO:0005743 mitochondrial inner membrane
GO:0045121 membrane raft
GO:0042645 mitochondrial nucleoid
GO:0005743 mitochondrial inner membrane
GO:0005739 mitochondrion
GO:0015853 adenine transport
GO:0015867 ATP transport
GO:0000295 adenine nucleotide transmembrane transporter activity
GO:0005515 protein binding
GO:0005515 protein binding
GO:0005515 protein binding
GO:0003723 RNA binding
GO:0051503 adenine nucleotide transport
GO:0005739 mitochondrion
GO:0005634 nucleus
GO:0016020 membrane |
| Organisms for which functions have been demonstrated | Homo sapiens (human, a mammal) |
| Sequence length | 298 |
| FASTA sequence | >sp|P05141|ADT2_HUMAN ADP/ATP translocase 2 OS=Homo sapiens OX=9606 GN=SLC25A5 PE=1 SV=7
MTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVR
IPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWLYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLVKIYKSDGIKGLYQGFNVS
VQGIIIYRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQTVTAVAGLTSYPFDTVRRRMMM
QSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYT |
| Structure Information |
| PDB ID | closest is from Bos taurus with 89% amino acid sequence identity |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | 3(109-131,172-194,209-231) |
| DisProt Annotation | Not in DisProt |
| Predicted Disorder Regions | Predicted disorder at N terminus (aa 1-3), and C terminus (aa 298) |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | mediates transmembrane exchange of ADP and ATP, providing ADP to the mitochondrial ATPase |
| References for function | 31618756 |
| E.C. number | NA |
| Location of functional site(s) | NA |
| Cellular location of function | Inner membrane of the mitochondria. |
| Comments | NA |
| Function 2 |
| Function description | ANT promotes mitophagy independently of its ADP/ATP exchange activity |
| References for function | NA |
| E.C. number | NA |
| Location of functional site(s) | Inner membrane of the mitochondria. |
| Cellular location of function | NA |
| Comments | NA |