| General Information |
| MoonProt ID | 4001 |
| First appeared in release | 4.0 |
| Name(s) | Homo sapiens (Human) |
| UniProt ID | Q0PNE2 |
| GO terms | "GO:0006412 translation
GO:0006457 protein folding
GO:0006914 autophagy
GO:0006915 apoptotic process
GO:0006986 response to unfolded protein
GO:0007626 locomotory behavior
GO:0010992 ubiquitin recycling
GO:0033554 cellular response to stress
GO:0046530 biological_process photoreceptor cell differentiation
GO:0048877 homeostasis of number of retina cells
GO:0050885 neuromuscular process controlling balance
GO:0050905 neuromuscular process
GO:0051402 neuron apoptotic process
GO:0060041 retina development in camera-type eye
GO:0061744 motor behavior
GO:0097352 autophagosome maturation
GO:0141084 inflammasome-mediated signaling pathway
GO:0005515 protein binding
GO:0005515 protein binding
GO:0002098 tRNA wobble uridine modification
GO:0002098 tRNA wobble uridine modification
GO:0006417 regulation of translation
GO:0008033 tRNA processing
GO:0030335 positive regulation of cell migration
GO:0030335 positive regulation of cell migration
GO:0005634 nucleus
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0033588 elongator holoenzyme complex
GO:0033588 elongator holoenzyme complex
GO:0033588 elongator holoenzyme complex
GO:0033588 elongator holoenzyme complex" |
| Organisms for which functions have been demonstrated | Homo sapiens (Human) |
| Sequence length | 266.0 |
| FASTA sequence | ">sp|Q0PNE2|ELP6_HUMAN Elongator complex protein 6 OS=Homo sapiens OX=9606 GN=ELP6 PE=1 SV=1
MFVELNNLLNTTPDRAEQGKLTLLCDAKTDGSFLVHHFLSFYLKANCKVCFVALIQSFSH
YSIVGQKLGVSLTMARERGQLVFLEGLKSAVDVVFQAQKEPHPLQFLREANAGNLKPLFE
FVREALKPVDSGEARWTYPVLLVDDLSVLLSLGMGAVAVLDFIHYCRATVCWELKGNMVV
LVHDSGDAEDEENDILLNGLSHQSHLILRAEGLATGFCRDVHGQLRILWRRPSQPAVHRD
QSFTYQYKIQDKSVSFFAKGMSPAVL" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | part of multiprotein complex |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | subunit of the Elongator tRNA-modifying complex that regulates protein translation |
| References for function | _ |
| E.C. number | NA |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | subunit of a complex that binds alpha-beta-tubulin heterodimers to affect microtubule growth |
| References for function | Planelles-HerreroPlanelles-Herrero VJ, Genova M, Krüger LK, Bittleston A, McNally KE, Morgan TE, Degliesposti G, Magiera MM, Janke C, Derivery E. Elongator is a microtubule polymerase selective for polyglutamylated tubulin. EMBO J. 2025 Mar;44(5):1322-1353. doi: 10.1038/s44318-024-00358-0. Epub 2025 Jan 15. PMID: 39815006; PMCID: PMC11876699. et al., 2025 |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |