| General Information |
| MoonProt ID | 4006 |
| First appeared in release | 4.0 |
| Name(s) | Drosophila melanogaster (Fruit fly) |
| UniProt ID | Q9VFW4 |
| GO terms | "GO:0005158 insulin receptor binding
GO:0002098 tRNA wobble uridine modification
GO:0008103 oocyte microtubule cytoskeleton polarization
GO:0035011 melanotic encapsulation of foreign target
GO:0046628 positive regulation of insulin receptor signaling pathway
GO:0061867 establishment of mitotic spindle asymmetry
GO:0005634 nucleus
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005819 spindle
GO:0005829 cytosol
GO:0005874 microtubule
GO:0033588 elongator holoenzyme complex
GO:0033588 elongator holoenzyme complex
GO:0033588 elongator holoenzyme complex" |
| Organisms for which functions have been demonstrated | Drosophila melanogaster (Fruit fly) |
| Sequence length | 251.0 |
| FASTA sequence | ">sp|Q9VFW4|ELP6_DROME Elongator complex protein 6 OS=Drosophila melanogaster OX=7227 GN=Elp6 PE=1 SV=1
MATSVLLACGLNEQKLPGFVHISEESNVDASFLISCVLGQRLRISNAGTLLVCLQHHYQH
YFNAGMRLGYNTNIFQGKTLGVIDVLSDMAGEGLASKWLTNTEGQTLTDQLVEDIRAQVE
RNYASRNSYTVLIDNLSILFNLGASKLQVQQFCQDLAALGKEREKLTVITKLSNSDIYQL
TDNNVAKLGQVRIQVLRLKSGVFREVDGKLLIERVLDEGNYACEETRKEVLYKVNDRNVK
VFAPGEIGVKV" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | subunit of a multiprotein complex |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | subunit of the Elongator tRNA-modifying complex that regulates protein translation |
| References for function | _ |
| E.C. number | NA |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | subunit of a complex that binds alpha-beta-tubulin heterodimers to affect microtubule growth |
| References for function | Planelles-Herrero VJ, Genova M, Krüger LK, Bittleston A, McNally KE, Morgan TE, Degliesposti G, Magiera MM, Janke C, Derivery E. Elongator is a microtubule polymerase selective for polyglutamylated tubulin. EMBO J. 2025 Mar;44(5):1322-1353. doi: 10.1038/s44318-024-00358-0. Epub 2025 Jan 15. PMID: 39815006; PMCID: PMC11876699. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |