| General Information |
| MoonProt ID | 401 |
| First appeared in release | 4.0 |
| Name(s) | isocitrate dehydrogenase 1 |
| UniProt ID | Q0QER9 |
| GO terms | GO:0000287 magnesium ion binding
GO:0004450 isocitrate dehydrogenase (NADP+) activity
GO:0016491 oxidoreductase activity
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0046872 metal ion binding
GO:0051287 NAD binding
GO:0006097 glyoxylate cycle
GO:0006099 tricarboxylic acid cycle
GO:0006102 isocitrate metabolic process
GO:0005777 peroxisome |
| Organisms for which functions have been demonstrated | Mus musculus |
| Sequence length | 378 |
| FASTA sequence | >tr|Q0QER9|Q0QER9_MOUSE isocitrate dehydrogenase (NADP(+)) (Fragment) OS=Mus musculus OX=10090 GN=Idh1 PE=2 SV=1
EKLILPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKYNVGVKCATITPDEKRVEEFK
LKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVTGWVKPIIIGRHAYGDQYRATDFVVP
GPGKVEITYTPKDGTQKVTYMVHDFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPL
YLSTKNTILKKYDGRFKDIFQEIYDKKYKSQFEAQNICYEHRLIDDMVAQAMKSEGGFIW
ACKNYDGDVQSDSVAQGYGSLGMMTSVLICPDGKTVEAEAAHGTVTRHYRMYQKGQETST
NPIASIFAWSRGLAHRAKLDNNTELSFFAKALEDVCIETIEAGFMTKDLAACIKGLPNVQ
RSDYLNTFEFMDKLGENL |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | NA |
| CATH | NA |
| TM Helix Prediction | |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, isocitrate dehydrogenase |
| References for function | Liu L, Lu JY, Li F, Xing X, Li T, Yang X, Shen X. IDH1 fine-tunes cap-dependent translation initiation. J Mol Cell Biol. 2019 Oct 25;11(10):816-828. doi: 10.1093/jmcb/mjz082. PMID: 31408165; PMCID: PMC6884706. |
| E.C. number | EC:1.1.1.42 |
| Location of functional site(s) | |
| Cellular location of function | mitochondria |
| Comments | |
| Function 2 |
| Function description | regulates mRNA translation by association with polysome mRNA and translation machinery |
| References for function | Liu L, Lu JY, Li F, Xing X, Li T, Yang X, Shen X. IDH1 fine-tunes cap-dependent translation initiation. J Mol Cell Biol. 2019 Oct 25;11(10):816-828. doi: 10.1093/jmcb/mjz082. PMID: 31408165; PMCID: PMC6884706. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |