| General Information |
| MoonProt ID | 4011 |
| First appeared in release | 4.0 |
| Name(s) | Schistosoma mansoni (Blood fluke) |
| UniProt ID | Q27877 |
| GO terms | "GO:0000287 magnesium ion binding
GO:0004634 phosphopyruvate hydratase activity
GO:0016829 lyase activity
GO:0046872 metal ion binding
GO:0006096 glycolytic process
GO:0005737 cytoplasm
GO:0000015 phosphopyruvate hydratase complex" |
| Organisms for which functions have been demonstrated | Schistosoma mansoni (Blood fluke) |
| Sequence length | 434.0 |
| FASTA sequence | ">sp|Q27877|ENO_SCHMA Enolase OS=Schistosoma mansoni OX=6183 GN=ENO PE=2 SV=1
MSILTIHARQIFDSRGNPTVEVDLKTSKGLFRAAVPSGASTGVHEALELRDTNSKAYMKK
GVLTAVSNVNKIIAPALINKNIPVTNQAAIDKYMIDLDGTENKEKLGANAILGVSLAVCK
AGAAEAGLPLYRYIARLAGHEDVIMPVPAFNVINGGSHAGNKLAMQEFMILPTGASSFTE
AMQIGTEVYHNLKAVIKREYGLDACNVGDEGGFAPNIQDNMKGLQLLEEAIKIAGYTGKV
EIGMDCAASEFHKNGKYDLDFKNPHSAESTWLSPDAMANMYKQMISKFPIVSIEDPFDQD
DWETWPKLTSSTNIQIVGDDLTVTNPKRIKQAIASKACNCLLLKVNQIGSLTESIEACKL
AQDSGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSDRLAKYNQLLRIEEELGT
AAKYAGKNFRHPKV" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme,enolase, interconversion of 2-phospho-D-glycerate (2-PGA) and phosphoenolpyruvate (PEP) |
| References for function | _ |
| E.C. number | EC:4.2.1.11 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds to plasminogen and aids its activation to plasmin in the presence of tissue plasminogen activator (tPA) |
| References for function | Figueiredo BC, Da'dara AA, Oliveira SC, Skelly PJ. Schistosomes Enhance Plasminogen Activation: The Role of Tegumental Enolase. PLoS Pathog. 2015 Dec 11;11(12):e1005335. doi: 10.1371/journal.ppat.1005335. PMID: 26658895; PMCID: PMC4676649. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |