| General Information |
| MoonProt ID | 4013 |
| First appeared in release | 4.0 |
| Name(s) | GAPC2 |
| UniProt ID | Q9FX54 |
| GO terms | "GO:0005794 Golgi apparatus
GO:0006094 gluconeogenesis
GO:0006096 glycolytic process
GO:0046686 response to cadmium ion
GO:0003677 DNA binding
GO:0004365 glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity
GO:0005507 copper ion binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016491 oxidoreductase activity
GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0050661 NADP binding
GO:0051287 NAD binding
GO:1901149 salicylic acid binding
GO:0005975 carbohydrate metabolic process
GO:0006006 glucose metabolic process
GO:0006096 glycolytic process
GO:0009408 response to heat
GO:0045893 positive regulation of DNA-templated transcription
GO:0005829 cytosol
GO:0005576 extracellular region" |
| Organisms for which functions have been demonstrated | Arabidopsis thaliana (Mouse-ear cress) |
| Sequence length | 338.0 |
| FASTA sequence | ">sp|Q9FX54|G3PC2_ARATH Glyceraldehyde-3-phosphate dehydrogenase GAPC2, cytosolic OS=Arabidopsis thaliana OX=3702 GN=GAPC2 PE=1 SV=1
MADKKIRIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKH
HELKVKDDKTLLFGEKPVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGGA
KKVVISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNCLAPLAKVINDRFGIVEGLMT
TVHSITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPSLNGKLTGMSFRVP
TVDVSVVDLTVRLEKAATYDEIKKAIKEESEGKMKGILGYTEDDVVSTDFVGDNRSSIFD
AKAGIALSDKFVKLVSWYDNEWGYSSRVVDLIVHMSKA" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, glyceraldehyde 3-phosphate dehydrogenase |
| References for function | _ |
| E.C. number | EC:1.2.1.12 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | RNA binding protein, regulations translation |
| References for function | Wegener M, Persicke M, Dietz KJ. Reprogramming the translatome during daily light transitions as affected by cytosolic glyceraldehyde-3-phosphate dehydrogenases GAPC1/C2. J Exp Bot. 2024 Apr 15;75(8):2494-2509. doi: 10.1093/jxb/erad509. PMID: 38156667. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |