| General Information |
| MoonProt ID | 4019 |
| First appeared in release | 4.0 |
| Name(s) | Ribosomal RNA small subunit methyltransferase C |
| UniProt ID | P39406 |
| GO terms | "GO:0003676 nucleic acid binding
GO:0005515 protein binding
GO:0008168 methyltransferase activity
GO:0008170 N-methyltransferase activity
GO:0008649 rRNA methyltransferase activity
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity
GO:0008990 rRNA (guanine-N2-)-methyltransferase activity
GO:0008990 rRNA (guanine-N2-)-methyltransferase activity
GO:0008990 rRNA (guanine-N2-)-methyltransferase activity
GO:0016740 transferase activity
GO:0052914 16S rRNA (guanine(1207)-N(2))-methyltransferase activity
GO:0052914 16S rRNA (guanine(1207)-N(2))-methyltransferase activity
GO:0140691 RNA folding chaperone
GO:0006364 rRNA processing
GO:0031167 rRNA methylation
GO:0031167 rRNA methylation
GO:0032259 methylation
GO:0034337 RNA folding
GO:0070475 rRNA base methylation
GO:0070475 rRNA base methylation
GO:0005737 cytoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol" |
| Organisms for which functions have been demonstrated | Escherichia coli (strain K12) |
| Sequence length | 343.0 |
| FASTA sequence | ">sp|P39406|RSMC_ECOLI Ribosomal RNA small subunit methyltransferase C OS=Escherichia coli (strain K12) OX=83333 GN=rsmC PE=1 SV=3
MSAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARLDTAASRAHTQQFHHWQVLSRQMG
DNARFSLVATADDVADCDTLIYYWPKNKPEAQFQLMNLLSLLPVGTDIFVVGENRSGVRS
AEQMLADYAPLNKVDSARRCGLYFGRLEKQPVFDAEKFWGEYSVDGLTVKTLPGVFSRDG
LDVGSQLLLSTLTPHTKGKVLDVGCGAGVLSVAFARHSPKIRLTLCDVSAPAVEASRATL
AANGVEGEVFASNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELR
IVANAFLPYPDVLDETFGFHEVIAQTGRFKVYRAIMTRQAKKG" |
| Structure Information |
| PDB ID | 2PJD |
| Quaternary structure | NA |
| SCOP | |
| CATH | 2pjdA01 , 2pjdA02 |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, ribosomal RNA methyltransferase RsmC |
| References for function | _ |
| E.C. number | EC:2.1.1.172 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | RNA chaperone and strand annealer during ribosome 30S biogenesis |
| References for function | Gc K, Gyawali P, Balci H, Abeysirigunawardena S. Ribosomal RNA Methyltransferase RsmC Moonlights as an RNA Chaperone. Chembiochem. 2020 Jul 1;21(13):1885-1892. doi: 10.1002/cbic.201900708. Epub 2020 Mar 6. PMID: 31972066. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | Cytoplasm |
| Comments | |