Protein Information

General Information
MoonProt ID402
First appeared in release3.0
Name(s)h-Type Thioredoxin, Trxs, Trx-h3, thioredoxin 3, Gene: TRX3
UniProt IDQ42403
GO termsGO:0016671 oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor GO:0006457 protein folding GO:0005829 cytosol GO:0010286 heat acclimation GO:0009408 response to heat GO:0005515 protein binding GO:0005515 protein binding GO:0005515 protein binding GO:0015035 protein disulfide oxidoreductase activity GO:0006662 glycerol ether metabolic process GO:0045454 cell redox homeostasis GO:0055114 oxidation-reduction process GO:0005737 cytoplasm GO:0016671 oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor GO:0005773 vacuole GO:0005794 Golgi apparatus GO:0005829 cytosol GO:0005829 cytosol GO:0009507 chloroplast GO:0005829 cytosol GO:0005829 cytosol GO:0050832 defense response to fungus GO:0005618 cell wall GO:0005739 mitochondrion GO:0005886 plasma membrane GO:0005886 plasma membrane GO:0009506 plasmodesma GO:0009570 chloroplast stroma GO:0009536 plastid GO:0010188 response to microbial phytotoxin GO:0005515 protein binding GO:0005515 protein binding GO:0005515 protein binding GO:0005515 protein binding GO:0005737 cytoplasm
Organisms for which functions have been demonstratedArabidopsis thaliana (Mouse-ear cress, a plant)
Sequence length118 amino acids
FASTA sequence>sp|Q42403|TRXH3_ARATH Thioredoxin H3 OS=Arabidopsis thaliana OX=3702 GN=TRX3 PE=1 SV=1 MAAEGEVIACHTVEDWTEKLKAANESKKLIVIDFTATWCPPCRFIAPVFADLAKKHLDVV FFKVDVDELNTVAEEFKVQAMPTFIFMKEGEIKETVVGAAKEEIIANLEKHKTVVAAA
Structure Information
PDB IDNone, but close to Chain A, Thioredoxin h1 [Arabidopsis thaliana](1XFL) with 63% match
Quaternary structureMonomeric/dimeric/multimeric
SCOPNA
CATHNA
TM Helix Predictionno TM helices
DisProt AnnotationNot in DisProt
Predicted Disorder RegionsPredicted disorder at N terminus (aa 1-7), and C terminus (aa 114-118)
Connections to Disease
OMIM ID
Function 1
Function descriptiondisulfide reductase, involved in activation of ribonucleotide reductase, modulation of transcription factors, promotion of a variety of tumors, and photosynthetic activity of plant cells
References for functionNA
E.C. numberNA
Location of functional site(s)two active cysteine residues C39/42
Cellular location of functioncytosol (sometimes in ER, mitochondria)
Commentslow molecular weight, regulated by heat shock & redox status
Function 2
Function descriptionChaperone, involved in assembly of the T7 DNA polymerase complex and the formation of fila- mentous phage
References for function19339505
E.C. numberNA
Location of functional site(s)Trx-fold-containing proteins interact with other proteins at the hydrophobic surface around their active site.
Cellular location of functioncytosol (sometimes in ER, mitochondria)
Commentshigh molecular weight, heat shock resistance, induced by heat shock