| General Information |
| MoonProt ID | 4020 |
| First appeared in release | 4.0 |
| Name(s) | GAPDH |
| UniProt ID | D0R533 |
| GO terms | "GO:0000166 nucleotide binding
GO:0016491 oxidoreductase activity
GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0050661 NADP binding
GO:0051287 NAD binding
GO:0006006 glucose metabolic process" |
| Organisms for which functions have been demonstrated | Lactobacillus johnsonii (strain FI9785) |
| Sequence length | 338.0 |
| FASTA sequence | ">tr|D0R533|D0R533_LACJF Glyceraldehyde-3-phosphate dehydrogenase OS=Lactobacillus johnsonii (strain FI9785) OX=633699 GN=gap PE=3 SV=1
MTVKIGINGFGRIGRLAFRRIMDLGEKSSDIEVVAINDLTTPALLAHLLKYDSTHGTFNH
EVSATDDSIVVDGKKYRVYAEPQAQNIPWVKNDGVDFVLECTGFYTSKAKSEAHLKAGAK
RVLISAPAGSDLKTIVYGVNDDTLTADDKIVSAGSCTTNSLAPMVNALQKEFGIEVGTMT
TIHAYTSTQMLLDGPVRGGNLRSARAAAINIIPHSTGAAKAIGLVVPELNGKLNGHAQRV
PVPDGSVTELVSILSKDVTADEVNEAVKKYESPSFAYNDHNIVSSDVLGMTAGSIFDPTQ
TMVTTAGDKQLVKTVAWYDNEYSFTCQMVRTLLKFATL" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, glyceraldehyde 3-phosphate dehydrogenase |
| References for function | _ |
| E.C. number | EC 1.2.1.12 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | bind to host JAM-2 protein, a junctional adhesion molecule in tight junctions |
| References for function | Bai Y, Lyu M, Fukunaga M, Watanabe S, Iwatani S, Miyanaga K, Yamamoto N. Lactobacillus johnsonii enhances the gut barrier integrity via the interaction between GAPDH and the mouse tight junction protein JAM-2. Food Funct. 2022 Oct 31;13(21):11021-11033. doi: 10.1039/d2fo00886f. PMID: 36069670. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | tight junctions |
| Comments | |