| General Information |
| MoonProt ID | 4023 |
| First appeared in release | 4.0 |
| Name(s) | 7-carboxy-7-deazaguanine synthase (from the queE gene) |
| UniProt ID | P64554 |
| GO terms | "GO:0032466 negative regulation of cytokinesis
GO:0000287 magnesium ion binding
GO:0003824 catalytic activity
GO:0016829 lyase activity
GO:0016840 carbon-nitrogen lyase activity
GO:0046872 metal ion binding
GO:0051536 iron-sulfur cluster binding
GO:0051539 4 iron, 4 sulfur cluster binding
GO:1904047 S-adenosyl-L-methionine binding
GO:0008616 tRNA queuosine(34) biosynthetic process
GO:0005829 cytosol
GO:0032153 cell division site" |
| Organisms for which functions have been demonstrated | Escherichia coli (strain K12 |
| Sequence length | 223.0 |
| FASTA sequence | ">sp|P64554|QUEE_ECOLI 7-carboxy-7-deazaguanine synthase OS=Escherichia coli (strain K12) OX=83333 GN=queE PE=3 SV=1
MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPVGCAWCDTKHTWEKLEDREVSLFSILAKTKESDKWGAASSEDLLAVIGRQGYTARHVVITGGEPCIHDLLPLTDLLEKNGFSCQIETSGTHEVRCTPNTWVTVSPKLNMRGGYEVLSQALERANEIKHPVGRVRDIEALDELLATLTDDKPRVIALQPISQKDDATRLCIETCIARNWRLSMQTHKYLNIA" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, 7-carboxy-7-deazaguanine or CDG synthase, catalyzes the conversion of the substrate CPH4 (6-carboxy-5,6,7,8-tetrahydropterin) to CDG (7-carboxy-7-deazaguanine), in pathway for queuosine (Q) tRNA modification |
| References for function | _ |
| E.C. number | 4.3.99.3 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds to cell division septal site, blocking division and resulting in filamentous growth |
| References for function | Adeleye SA, Yadavalli SS. Queuosine biosynthetic enzyme, QueE moonlights as a cell division regulator. PLoS Genet. 2024 May 20;20(5):e1011287. doi: 10.1371/journal.pgen.1011287. PMID: 38768229; PMCID: PMC11142719. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell division septum |
| Comments | |