| General Information |
| MoonProt ID | 4029 |
| First appeared in release | 4.0 |
| Name(s) | 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase |
| UniProt ID | G4VJD5 |
| GO terms | GO:0004619 phosphoglycerate mutase activity ; GO:0004619 phosphoglycerate mutase activity ; GO:0016853 isomerase activity ; GO:0016868 intramolecular phosphotransferase activity ; GO:0006096 glycolytic process ; GO:0044542 symbiont-mediated activation of host plasminogen ; GO:0061621 canonical glycolysis |
| Organisms for which functions have been demonstrated | Schistosoma mansoni (Blood fluke) |
| Sequence length | 250.0 |
| FASTA sequence | ">sp|G4VJD5|PGM_SCHMA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Schistosoma mansoni OX=6183 GN=Smp_096760 PE=1 SV=1
MAPYRIVFIRHGESVYNEENRFCGWHDADLSGQGITEAKQAGQLLRQNHFTFDIAYTSVL
KRAIKTLNFVLDELDLNWIPVTKTWRLNERMYGALQGLNKSETAAKHGEEQVKIWRRAYD
IPPPPVDISDPRFPGNEPKYALLDSSCIPRTECLKDTVQRVLPFWFDTISASIKRREQVL
IVAHGNSLRALIKYLDNTSDSDIVELNIPTGIPLVYELDANLKPTKHYYLADEATVAAAI
ARVANQGKKK" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme, 3-ketoacyl-ACP reductase keto reduction step in elognation step of fatty acid synthesis. |
| References for function | _ |
| E.C. number | EC:5.4.2.11 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | binds plasminogen |
| References for function | Pirovich DB, Da'dara AA, Skelly PJ. Schistosoma mansoni phosphoglycerate mutase: a glycolytic ectoenzyme with thrombolytic potential. Parasite. 2022;29:41. doi: 10.1051/parasite/2022042. Epub 2022 Sep 9. PMID: 36083036; PMCID: PMC9461710. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | cell surface |
| Comments | |