| General Information |
| MoonProt ID | 4034 |
| First appeared in release | 4.0 |
| Name(s) | phosphomannose isomerase |
| UniProt ID | O51368 |
| GO terms | "GO:0004476 mannose-6-phosphate isomerase activity , GO:0008270 zinc ion binding , GO:0016853 isomerase activity , GO:0046872 metal ion binding , GO:0005975 carbohydrate metabolic process , GO:0009298 GDP-mannose biosynthetic process , GO:0005829 cytosol , GO:0005829 cytosol" |
| Organisms for which functions have been demonstrated | Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) (Borrelia burgdorferi) |
| Sequence length | 372.0 |
| FASTA sequence | ">tr|O51368|O51368_BORBU mannose-6-phosphate isomerase OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=manA PE=3 SV=1
MNNEDNIFLMKNNIKEYDWGGINFIPNLLGDKIDGKPKAEMWLGAHKTFSSKILYKNEYV
LLSDFLEDHKELLGCNDEFPFLLKVLSANKPLSIQIHPSKDIALKGYESENNKGIDINDP
KRTYKDKNPKIELIYALSDFYALKGFLPLDEIKKIYEILELNFDFQSHKDFVKTIFDLQM
YELEKIIEKILKNLDLIDNFRGYWFNEIYNIYGIDVGLLVFLGMNILKLKPGEVVYTNSQ
EVHAYLKGDCIELMTNSDNVIRAGLTTKYIDKDEMLRVGQFEEGKLSFLNPDFQDNFSVF
RLPNTNLKLIQKKINENICINRNSAMVLLVLNGCVSINKSLNLKKGESIFIGKKAENLFI
DGDGEAFIAGFN" |
| Structure Information |
| PDB ID | NA |
| Quaternary structure | NA |
| SCOP | |
| CATH | |
| TM Helix Prediction | no TM helices |
| DisProt Annotation | |
| Predicted Disorder Regions | |
| Connections to Disease |
| OMIM ID | |
| Function 1 |
| Function description | enzyme = phosphomannose isomerase |
| References for function | _ |
| E.C. number | 5.3.1.8 |
| Location of functional site(s) | |
| Cellular location of function | cytoplasm |
| Comments | |
| Function 2 |
| Function description | adhesin, binds collagen |
| References for function | Dutta S, Rana VS, Backstedt BT, Shakya AK, Kitsou C, Yas OB, Smith AA, Ronzetti MH, Lipman RM, Araujo-Aris S, Yang X, Rai G, Lin Y-P, Herzberg O, Pal U. Borrelial phosphomannose isomerase as a cell surface localized protein that retains enzymatic activity and promotes host-pathogen interaction. mBio. 2025 Mar 12;16(3):e0360924. doi: 10.1128/mbio.03609-24. Epub 2025 Feb 11. PMID: 39932273; PMCID: PMC11898738. |
| E.C. number | |
| Location of functional site(s) | |
| Cellular location of function | Bacterial cell surface |
| Comments | |